BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 029347
(194 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4ES8|A Chain A, Crystal Structure Of The Adhesin Domain Of Epf From
Streptococcus Pyogenes In P212121
pdb|4ES8|B Chain B, Crystal Structure Of The Adhesin Domain Of Epf From
Streptococcus Pyogenes In P212121
pdb|4ES9|A Chain A, Crystal Structure Of The Adhesin Domain Of Epf From
Streptococcus Pyogenes In P21
pdb|4ES9|B Chain B, Crystal Structure Of The Adhesin Domain Of Epf From
Streptococcus Pyogenes In P21
pdb|4ES9|C Chain C, Crystal Structure Of The Adhesin Domain Of Epf From
Streptococcus Pyogenes In P21
pdb|4ES9|D Chain D, Crystal Structure Of The Adhesin Domain Of Epf From
Streptococcus Pyogenes In P21
Length = 320
Score = 32.0 bits (71), Expect = 0.21, Method: Compositional matrix adjust.
Identities = 18/62 (29%), Positives = 29/62 (46%)
Query: 132 LLNDCQTSPNQELCPRFTNCEIRSVVIVDQSIRGSCYPGTISGELRLPADVAKENIPREE 191
LL+ + P +L F N +I V Q +G Y G + +L L +D + N +E
Sbjct: 190 LLSKVEKKPQGDLDVEFKNLKIIDVTNPSQLDKGVAYVGNKNVQLTLKSDDGRTNFEGDE 249
Query: 192 VS 193
+S
Sbjct: 250 IS 251
>pdb|2L82|A Chain A, Solution Nmr Structure Of De Novo Designed Protein, P-Loop
Ntpase Fold, Northeast Structural Genomics Consortium
Target Or32
Length = 162
Score = 27.7 bits (60), Expect = 4.7, Method: Compositional matrix adjust.
Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 3/46 (6%)
Query: 58 DKRRSISEYHSLFPAIDFKLIESEDDKLWKADAREPFEEVTARGME 103
D R +I E +P +D +I + DDK W D EE RG+E
Sbjct: 63 DFRENIREIWERYPQLDVVVIVTTDDKEWIKDF---IEEAKERGVE 105
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.135 0.415
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,654,727
Number of Sequences: 62578
Number of extensions: 206502
Number of successful extensions: 511
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 509
Number of HSP's gapped (non-prelim): 2
length of query: 194
length of database: 14,973,337
effective HSP length: 94
effective length of query: 100
effective length of database: 9,091,005
effective search space: 909100500
effective search space used: 909100500
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)