BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029359
         (194 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4ES8|A Chain A, Crystal Structure Of The Adhesin Domain Of Epf From
           Streptococcus Pyogenes In P212121
 pdb|4ES8|B Chain B, Crystal Structure Of The Adhesin Domain Of Epf From
           Streptococcus Pyogenes In P212121
 pdb|4ES9|A Chain A, Crystal Structure Of The Adhesin Domain Of Epf From
           Streptococcus Pyogenes In P21
 pdb|4ES9|B Chain B, Crystal Structure Of The Adhesin Domain Of Epf From
           Streptococcus Pyogenes In P21
 pdb|4ES9|C Chain C, Crystal Structure Of The Adhesin Domain Of Epf From
           Streptococcus Pyogenes In P21
 pdb|4ES9|D Chain D, Crystal Structure Of The Adhesin Domain Of Epf From
           Streptococcus Pyogenes In P21
          Length = 320

 Score = 32.0 bits (71), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 29/62 (46%)

Query: 132 LLNDCQTSPNQELCPRFTNCEIRSVVIVDQSIRGSCYPGTISGELRLPADVAKENIPREE 191
           LL+  +  P  +L   F N +I  V    Q  +G  Y G  + +L L +D  + N   +E
Sbjct: 190 LLSKVEKKPQGDLDVEFKNLKIIDVTNPSQLDKGVAYVGNKNVQLTLKSDDGRTNFEGDE 249

Query: 192 VS 193
           +S
Sbjct: 250 IS 251


>pdb|2L82|A Chain A, Solution Nmr Structure Of De Novo Designed Protein, P-Loop
           Ntpase Fold, Northeast Structural Genomics Consortium
           Target Or32
          Length = 162

 Score = 27.7 bits (60), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 58  DKRRSISEYHSLFPAIDFKLIESEDDKLWKADAREPFEEVTARGME 103
           D R +I E    +P +D  +I + DDK W  D     EE   RG+E
Sbjct: 63  DFRENIREIWERYPQLDVVVIVTTDDKEWIKDF---IEEAKERGVE 105


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.135    0.415 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,654,727
Number of Sequences: 62578
Number of extensions: 206502
Number of successful extensions: 511
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 509
Number of HSP's gapped (non-prelim): 2
length of query: 194
length of database: 14,973,337
effective HSP length: 94
effective length of query: 100
effective length of database: 9,091,005
effective search space: 909100500
effective search space used: 909100500
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)