Citrus Sinensis ID: 029411

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----

MSRSSAGTAASRVGDDPALDQFMEAYCEMLTKYEQELTKPFKDASLFLSEIDAQLKTLTVSSNISGQSGSSEEEIDVKDHCIDPLAEDRDLKDQLLRRYSGSLGSLKQEFLKKKKKGKLPKEARQLLLDWWSRHHRWPYPSEPQKLALAESTGLDQKQINNWFINQRKRHWKPSEDMQFNDISIMNGPEGDAAV

ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHccccccccccccHHHHHHHHHHHHccccccHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccc

*****************ALDQFMEAYCEMLTKYEQELTKPFKDASLFLSEIDAQLKTL****************************************************************ARQLLLDWWSRHHRWPYPSEPQKLALAESTGLDQKQINNWFINQRKRHWK**********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSRSSAGTAASRVGDDPALDQFMEAYCEMLTKYEQELTKPFKDASLFLSEIDAQLKTLTVSSNISGQSGSSEEEIDVKDHCIDPLAEDRDLKDQLLRRYSGSLGSLKQEFLKKKKKGKLPKEARQLLLDWWSRHHRWPYPSEPQKLALAESTGLDQKQINNWFINQRKRHWKPSEDMQFNDISIMNGPEGDAAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Homeobox protein SBH1	Possible transcription activator involved in early embryonic development. Probably binds to the DNA sequence 5'-TGAC-3'.	probable	P46608
Homeobox protein SHOOT MERISTEMLESS	Required for shoot apical meristem (SAM) formation during embryogenesis. Negatively regulates ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2 or LBD6). Probably binds to the DNA sequence 5'-TGAC-3'.	probable	Q38874

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DMN, chain A
Confidence level:very confident
Coverage over the Query: 111-178
View the alignment between query and template
View the model in PyMOL