Citrus Sinensis ID: 029449


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190---
MGQAFRKLFDVFFGNSEMRVVMLGLDAAGKTTILYKLHIGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQAIIKDPFMLNSVILVFANKQDMKGAMTPMEVCEGLGLFDLKNRKWHIQGTCALKGDGLYEGLDWLASTLKEMRAAGYSSVGTSSF
cccHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHcccEEEEccccccEEEEEEEccEEEEEEECccccccccccccccccccEEEEEEEcccHHHHHHHHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccc
*GQAFRKLFDVFFGNSEMRVVMLGLDAAGKTTILYKLHIGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQAIIKDPFMLNSVILVFANKQDMKGAMTPMEVCEGLGLFDLKNRKWHIQGTCALKGDGLYEGLDWLASTLK***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQAFRKLFDVFFGNSEMRVVMLGLDAAGKTTILYKLHIGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQAIIKDPFMLNSVILVFANKQDMKGAMTPMEVCEGLGLFDLKNRKWHIQGTCALKGDGLYEGLDWLASTLKEMRAAGYSSVGTSSF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ADP-ribosylation factor 1 GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.probableO00909
ADP-ribosylation factor 2 GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.probableP19146
ADP-ribosylation factor 2 GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.probableQ8BSL7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LVQ, chain E
Confidence level:very confident
Coverage over the Query: 15-178
View the alignment between query and template
View the model in PyMOL