Citrus Sinensis ID: 029517

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MFSLFYGLWKYIFTKTEFHTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWLVEVMERSKRTEMLRARAGASTGSV
cHHHHHHHHHHHccccEEEEEEEEHHHHHHHccccccccccccccccEEEEEEccEEEEEEEEccccccccHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHcccccccccEEEEEccccccccccHHHHHHHccccccccccEEEEEccccccccHHHHHHHHHHHHHHccccHHHHHHcccccccc
MFSLFYGLWKYIFTKTEFHTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWLVEVM********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSLFYGLWKYIFTKTEFHTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWLVEVMERSKRTEMLRARAGASTGSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ADP-ribosylation factor-related protein 1 Possibly involved in plasma membrane-related signaling events.probableQ5R579
ADP-ribosylation factor-related protein 1 Possibly involved in plasma membrane-related signaling events.probableQ8BXL7
ADP-ribosylation factor-related protein 1 Possibly involved in plasma membrane-related signaling events.probableQ13795

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X77, chain A
Confidence level:very confident
Coverage over the Query: 4-176
View the alignment between query and template
View the model in PyMOL