Query         029519
Match_columns 192
No_of_seqs    162 out of 266
Neff          4.0 
Searched_HMMs 46136
Date          Fri Mar 29 14:12:53 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/029519.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/029519hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4343 bZIP transcription fac  98.3 6.2E-07 1.3E-11   86.4   3.5   32  158-189   274-305 (655)
  2 smart00338 BRLZ basic region l  97.5 8.8E-05 1.9E-09   51.9   3.1   27  163-189     3-29  (65)
  3 PF00170 bZIP_1:  bZIP transcri  97.0 0.00047   1E-08   48.1   2.6   26  164-189     4-29  (64)
  4 PF07716 bZIP_2:  Basic region   96.8  0.0012 2.6E-08   45.0   3.0   26  163-189     3-28  (54)
  5 KOG3584 cAMP response element   96.7  0.0015 3.4E-08   59.5   3.4   33  158-190   284-316 (348)
  6 KOG0709 CREB/ATF family transc  96.0  0.0059 1.3E-07   58.3   3.6   31  160-190   246-276 (472)
  7 PF03131 bZIP_Maf:  bZIP Maf tr  92.4    0.21 4.6E-06   37.3   4.1   29  160-188    25-53  (92)
  8 KOG4005 Transcription factor X  72.6     3.7   8E-05   37.2   3.1   40  148-188    53-92  (292)
  9 smart00243 GAS2 Growth-Arrest-  44.9      10 0.00022   28.3   0.8   11   79-89     56-66  (73)
 10 cd08533 SAM_PNT-ETS-1,2 Steril  40.9      15 0.00033   26.8   1.2   13   79-91     42-54  (71)
 11 cd08531 SAM_PNT-ERG_FLI-1 Ster  40.2      16 0.00034   26.9   1.2   13   79-91     44-56  (75)
 12 cd08203 SAM_PNT Sterile alpha   38.0      19 0.00041   25.5   1.3   13   79-91     40-52  (66)
 13 cd08757 SAM_PNT_ESE Sterile al  35.8      20 0.00044   25.6   1.1   13   79-91     42-54  (68)
 14 cd08540 SAM_PNT-ERG Sterile al  30.6      28  0.0006   25.7   1.2   14   79-92     44-57  (75)
 15 cd08532 SAM_PNT-PDEF-like Ster  30.5      28  0.0006   25.7   1.2   41   51-91     10-59  (76)
 16 cd08534 SAM_PNT-GABP-alpha Ste  28.1      32 0.00069   26.2   1.2   44   48-91     16-69  (89)
 17 cd08535 SAM_PNT-Tel_Yan Steril  27.1      34 0.00074   24.7   1.1   12   79-90     41-52  (68)
 18 cd08536 SAM_PNT-Mae Sterile al  26.9      34 0.00073   24.5   1.0   13   79-91     40-52  (66)
 19 cd08538 SAM_PNT-ESE-2-like Ste  26.5      36 0.00078   25.5   1.1   14   79-92     47-60  (78)
 20 smart00251 SAM_PNT SAM / Point  26.4      36 0.00078   25.1   1.2   41   50-90     16-66  (82)
 21 PF09279 EF-hand_like:  Phospho  25.8      59  0.0013   22.8   2.2   10   56-65      2-11  (83)
 22 PF02187 GAS2:  Growth-Arrest-S  25.2      38 0.00082   25.2   1.1   11   79-89     56-66  (73)
 23 cd08542 SAM_PNT-ETS-1 Sterile   25.0      39 0.00084   25.8   1.1   45   47-91     15-69  (88)
 24 PF01475 FUR:  Ferric uptake re  24.8      79  0.0017   23.7   2.8   38   53-94     23-60  (120)
 25 PF04450 BSP:  Peptidase of pla  24.2      35 0.00075   29.3   0.8   14   49-62    191-204 (205)
 26 cd08541 SAM_PNT-FLI-1 Sterile   24.1      45 0.00097   25.6   1.3   46   47-92     13-69  (91)
 27 KOG3330 Transport protein part  22.9      43 0.00094   28.7   1.1   13   81-93     57-69  (183)
 28 PF03698 UPF0180:  Uncharacteri  22.2      69  0.0015   24.0   2.0   17   49-65     61-77  (80)
 29 TIGR02010 IscR iron-sulfur clu  21.1      59  0.0013   25.3   1.5   32   53-90    103-134 (135)
 30 KOG3170 Conserved phosducin-li  21.0      64  0.0014   28.8   1.8   16   80-95    191-207 (240)
 31 PF00727 IL4:  Interleukin 4 Th  21.0      49  0.0011   26.6   1.0   12   79-90     98-109 (117)
 32 PF12221 HflK_N:  Bacterial mem  20.5      66  0.0014   21.4   1.4   11   55-65     22-32  (42)
 33 cd04405 RhoGAP_BRCC3-like RhoG  20.4      43 0.00094   29.8   0.7   16   51-66      1-16  (235)

No 1  
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription]
Probab=98.25  E-value=6.2e-07  Score=86.36  Aligned_cols=32  Identities=50%  Similarity=0.590  Sum_probs=29.9

Q ss_pred             hhhHHHHHHHHHhhhhhHHHHHHHHHHhhhhh
Q 029519          158 PLDKAAQQRQRRMIKNRESAARSRERKQVTKL  189 (192)
Q Consensus       158 ~~~~~~~r~~~r~~~nresa~rsr~rkq~~~~  189 (192)
                      .+|..+-+|+.|||||||||+.||+||++|.+
T Consensus       274 ~~d~kv~krqQRmIKNResA~~SRkKKKEy~~  305 (655)
T KOG4343|consen  274 GSDIKVLKRQQRMIKNRESACQSRKKKKEYML  305 (655)
T ss_pred             ccCHHHHHHHHHHHhhHHHHHHHHHHHHHHHH
Confidence            46889999999999999999999999999986


No 2  
>smart00338 BRLZ basic region leucin zipper.
Probab=97.51  E-value=8.8e-05  Score=51.87  Aligned_cols=27  Identities=48%  Similarity=0.636  Sum_probs=24.6

Q ss_pred             HHHHHHHhhhhhHHHHHHHHHHhhhhh
Q 029519          163 AQQRQRRMIKNRESAARSRERKQVTKL  189 (192)
Q Consensus       163 ~~r~~~r~~~nresa~rsr~rkq~~~~  189 (192)
                      ++++.+|+++||++|+++|.||++|+.
T Consensus         3 ~~k~~rR~~rNR~aA~~~R~rKk~~~~   29 (65)
T smart00338        3 DEKRRRRRERNREAARRSRERKKAEIE   29 (65)
T ss_pred             cHHHHHHHHHhHHHHHHHHHHHHHHHH
Confidence            468899999999999999999999974


No 3  
>PF00170 bZIP_1:  bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature;  InterPro: IPR011616  The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0046983 protein dimerization activity, 0006355 regulation of transcription, DNA-dependent; PDB: 2H7H_B 2OQQ_B 1S9K_E 1JNM_A 1JUN_A 1FOS_H 1A02_J 1T2K_C 1CI6_A 1DH3_C ....
Probab=97.04  E-value=0.00047  Score=48.11  Aligned_cols=26  Identities=46%  Similarity=0.589  Sum_probs=23.4

Q ss_pred             HHHHHHhhhhhHHHHHHHHHHhhhhh
Q 029519          164 QQRQRRMIKNRESAARSRERKQVTKL  189 (192)
Q Consensus       164 ~r~~~r~~~nresa~rsr~rkq~~~~  189 (192)
                      .++.+|+++||++|+++|.||++|+-
T Consensus         4 ~k~~~rr~rNR~AAr~~R~RKk~~~~   29 (64)
T PF00170_consen    4 DKRERRRERNREAARRSRQRKKQYIE   29 (64)
T ss_dssp             -CHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHhhHH
Confidence            47899999999999999999999974


No 4  
>PF07716 bZIP_2:  Basic region leucine zipper;  InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0046983 protein dimerization activity, 0006355 regulation of transcription, DNA-dependent; PDB: 1NWQ_A 1H89_B 1H88_A 1GTW_B 2E43_A 1IO4_A 1GU4_B 2E42_A 1H8A_B 1GU5_B ....
Probab=96.82  E-value=0.0012  Score=44.96  Aligned_cols=26  Identities=46%  Similarity=0.694  Sum_probs=22.8

Q ss_pred             HHHHHHHhhhhhHHHHHHHHHHhhhhh
Q 029519          163 AQQRQRRMIKNRESAARSRERKQVTKL  189 (192)
Q Consensus       163 ~~r~~~r~~~nresa~rsr~rkq~~~~  189 (192)
                      .+.+.+|. +||++|++||.||++|+.
T Consensus         3 ~~~~~rR~-rNr~AA~r~R~rkk~~~~   28 (54)
T PF07716_consen    3 EEKRERRE-RNREAARRSRQRKKQREE   28 (54)
T ss_dssp             HHHHHHHH-HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHH-HHHHHHHHHHHHHHHHHH
Confidence            46778888 999999999999999864


No 5  
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription]
Probab=96.65  E-value=0.0015  Score=59.55  Aligned_cols=33  Identities=33%  Similarity=0.572  Sum_probs=29.7

Q ss_pred             hhhHHHHHHHHHhhhhhHHHHHHHHHHhhhhhh
Q 029519          158 PLDKAAQQRQRRMIKNRESAARSRERKQVTKLC  190 (192)
Q Consensus       158 ~~~~~~~r~~~r~~~nresa~rsr~rkq~~~~~  190 (192)
                      ..|....+|+-|++||||-|++=|.||++|.-|
T Consensus       284 ~aee~trKRevRLmKNREAARECRRKKKEYVKC  316 (348)
T KOG3584|consen  284 GAEEATRKREVRLMKNREAARECRRKKKEYVKC  316 (348)
T ss_pred             cchhhhhHHHHHHHhhHHHHHHHHHhHhHHHHH
Confidence            446677789999999999999999999999988


No 6  
>KOG0709 consensus CREB/ATF family transcription factor [Transcription]
Probab=96.02  E-value=0.0059  Score=58.32  Aligned_cols=31  Identities=32%  Similarity=0.375  Sum_probs=27.4

Q ss_pred             hHHHHHHHHHhhhhhHHHHHHHHHHhhhhhh
Q 029519          160 DKAAQQRQRRMIKNRESAARSRERKQVTKLC  190 (192)
Q Consensus       160 ~~~~~r~~~r~~~nresa~rsr~rkq~~~~~  190 (192)
                      +..+.+|-+|+|+|++||..||+|||+|.=|
T Consensus       246 EEriLKrvRRKIrNK~SAQESRrkKkeYid~  276 (472)
T KOG0709|consen  246 EERILKRVRRKIRNKRSAQESRRKKKEYIDG  276 (472)
T ss_pred             HHHHHHHHHHHHHhhhhhHHHHHhHhhHHHH
Confidence            5567788999999999999999999999754


No 7  
>PF03131 bZIP_Maf:  bZIP Maf transcription factor;  InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell. MafG and MafH are small Mafs which lack a putative transactivation domain. They behave as transcriptional repressors when they dimerize among themselves. However they also serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Maf transcription factors contain a conserved basic region leucine zipper (bZIP) domain, which mediates their dimerization and DNA binding property. Neural retina-specific leucine zipper proteins also belong to this family. Together with the basic region, the Maf extended homology region (EHR), conserved only within the Maf family, defines the DNA binding specific to Mafs. This structure enables Mafs to make a broader area of contact with DNA and to recognise longer DNA sequences. In particular, the two residues at the beginning of helix H2 are positioned to recognise the flanking region []. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF2-E2 transcription factor.  In mouse, Maf1 may play an early role in axial patterning. Defects in these proteins are a cause of autosomal dominant retinitis pigmentosa. ; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2KZ5_A 3A5T_A 1K1V_A 1SKN_P 2WT7_B 2WTY_B.
Probab=92.41  E-value=0.21  Score=37.30  Aligned_cols=29  Identities=34%  Similarity=0.385  Sum_probs=24.2

Q ss_pred             hHHHHHHHHHhhhhhHHHHHHHHHHhhhh
Q 029519          160 DKAAQQRQRRMIKNRESAARSRERKQVTK  188 (192)
Q Consensus       160 ~~~~~r~~~r~~~nresa~rsr~rkq~~~  188 (192)
                      +...-+..+|-+|||..|+++|.||..++
T Consensus        25 q~~~lK~~RRr~KNR~~A~~cR~rk~~~~   53 (92)
T PF03131_consen   25 QIAELKQRRRRLKNRGYAQNCRKRKLDQI   53 (92)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45555778888999999999999998765


No 8  
>KOG4005 consensus Transcription factor XBP-1 [Transcription]
Probab=72.64  E-value=3.7  Score=37.16  Aligned_cols=40  Identities=38%  Similarity=0.483  Sum_probs=28.0

Q ss_pred             CCCcCccccchhhHHHHHHHHHhhhhhHHHHHHHHHHhhhh
Q 029519          148 RGKRGRVMLEPLDKAAQQRQRRMIKNRESAARSRERKQVTK  188 (192)
Q Consensus       148 ~~~RkR~~~~~~~~~~~r~~~r~~~nresa~rsr~rkq~~~  188 (192)
                      .++|||.-.+.+ .-.|+-++|++|||--|.-+|-||+++.
T Consensus        53 ~~~rKr~RL~HL-S~EEK~~RrKLKNRVAAQtaRDrKKaRm   92 (292)
T KOG4005|consen   53 QPKRKRRRLDHL-SWEEKVQRRKLKNRVAAQTARDRKKARM   92 (292)
T ss_pred             chHHHHHhhccc-CHHHHHHHHHHHHHHHHhhhhhHHHHHH
Confidence            445655432222 2345667889999999999999999874


No 9  
>smart00243 GAS2 Growth-Arrest-Specific Protein 2 Domain. GROWTH-ARREST-SPECIFIC PROTEIN 2 Domain
Probab=44.86  E-value=10  Score=28.33  Aligned_cols=11  Identities=36%  Similarity=0.582  Sum_probs=9.6

Q ss_pred             cccHHHHHhhh
Q 029519           79 MMTLEDFLAKA   89 (192)
Q Consensus        79 eMTLEDFLvKA   89 (192)
                      =||||+||.|-
T Consensus        56 W~tL~~fL~kh   66 (73)
T smart00243       56 WETLDEYLLKH   66 (73)
T ss_pred             HHHHHHHHHhC
Confidence            49999999984


No 10 
>cd08533 SAM_PNT-ETS-1,2 Sterile alpha motif (SAM)/Pointed domain of ETS-1,2 family. SAM Pointed domain of ETS-1,2 family of transcriptional activators is a protein-protein interaction domain. It carries a kinase docking site and mediates interaction between ETS transcriptional activators and protein kinases. This group of transcriptional factors is involved in the Ras/MAP kinase signaling pathway. MAP kinases phosphorylate the transcription factors.  Phosphorylated factors then recruit coactivators and enhance transactivation. Members of this group play a role in regulation of different embryonic developmental processes. ETS-1,2 transcriptional activators are proto-oncogenes involved in malignant transformation and tumor progression. They are potential molecular targets for selective cancer therapy.
Probab=40.90  E-value=15  Score=26.83  Aligned_cols=13  Identities=31%  Similarity=0.299  Sum_probs=11.6

Q ss_pred             cccHHHHHhhhcc
Q 029519           79 MMTLEDFLAKAGA   91 (192)
Q Consensus        79 eMTLEDFLvKAGv   91 (192)
                      .||.|||+.+|+.
T Consensus        42 ~ls~edF~~~~p~   54 (71)
T cd08533          42 ALGKERFLELAPD   54 (71)
T ss_pred             cCCHHHHHHHcCC
Confidence            6999999999874


No 11 
>cd08531 SAM_PNT-ERG_FLI-1 Sterile alpha motif (SAM)/Pointed domain of ERG (Ets related gene) and FLI-1 (Friend leukemia integration 1) transcription factors. SAM Pointed domain of ERG/FLI-1 subfamily of ETS transcriptional regulators is a putative protein-protein interaction domain. The ERG and FLI regulators are involved in endothelial cell differentiation, bone morphogenesis and neural crest development. They are proto-oncogenes implicated in cancer development such as myeloid leukemia, Ewing's sarcoma and erythroleukemia. Members of this subfamily are potential targets for cancer therapy.
Probab=40.21  E-value=16  Score=26.93  Aligned_cols=13  Identities=54%  Similarity=0.598  Sum_probs=11.3

Q ss_pred             cccHHHHHhhhcc
Q 029519           79 MMTLEDFLAKAGA   91 (192)
Q Consensus        79 eMTLEDFLvKAGv   91 (192)
                      .||.|||+.+++.
T Consensus        44 ~lt~edF~~~~~~   56 (75)
T cd08531          44 KMTKEDFLRLTSA   56 (75)
T ss_pred             cCCHHHHHHHcCC
Confidence            6999999999854


No 12 
>cd08203 SAM_PNT Sterile alpha motif (SAM)/Pointed domain. Sterile alpha motif (SAM)/Pointed domain is found in about 40% of transcriptional regulators of ETS family (initially named for Erythroblastosis virus, E26-E Twenty Six).  SAM Pointed domain containing proteins of this family additionally have C-terminal ETS DNA-binding domain. In a few cases, SAM Pointed domain appears as a single domain protein.  Members of this group are mostly involved in regulation of embryonic development and growth control in eukaryotes. SAM Pointed domains mediate protein-protein interactions. Depending on the subgroup, they can interact with other SAM Pointed domains forming homo or hetero dimers/oligomers and/or they can recruit a protein kinase to its target which can be the SAM Pointed domain containing protein itself or another protein that has no kinase docking site. Thus, SAM Pointed domains participate in transcriptional regulation and signal transduction. Some genes coding ETS family transcripti
Probab=38.03  E-value=19  Score=25.47  Aligned_cols=13  Identities=46%  Similarity=0.751  Sum_probs=11.7

Q ss_pred             cccHHHHHhhhcc
Q 029519           79 MMTLEDFLAKAGA   91 (192)
Q Consensus        79 eMTLEDFLvKAGv   91 (192)
                      .||.|||+.+++.
T Consensus        40 ~ls~edF~~~~p~   52 (66)
T cd08203          40 LLTKEDFLRRAPS   52 (66)
T ss_pred             hCCHHHHHHHcCC
Confidence            6999999999875


No 13 
>cd08757 SAM_PNT_ESE Sterile alpha motif (SAM)/Pointed domain of ESE-like ETS transcriptional regulators. SAM Pointed domain of ESE-like (Epithelium-Specific ETS) subfamily of ETS transcriptional regulators is a putative protein-protein interaction domain. It can act as a major transactivator by providing a potential docking site for co-activators. ETS factors are important for cell differentiation. They can be involved in regulation of gene expression in different types of epithelial cells. They are expressed in salivary gland, intestine, stomach, pancreas, lungs, kidneys, colon, mammary gland, and prostate. Members of this group are proto-oncogenes. Expression profiles of these factors are altered in epithelial cancers, which makes them potential targets for cancer therapy.
Probab=35.75  E-value=20  Score=25.58  Aligned_cols=13  Identities=46%  Similarity=0.601  Sum_probs=11.7

Q ss_pred             cccHHHHHhhhcc
Q 029519           79 MMTLEDFLAKAGA   91 (192)
Q Consensus        79 eMTLEDFLvKAGv   91 (192)
                      .||.|||+.+++.
T Consensus        42 ~ms~edF~~~~p~   54 (68)
T cd08757          42 SMTEEEFREAAGS   54 (68)
T ss_pred             cCCHHHHHHHcCC
Confidence            6999999999875


No 14 
>cd08540 SAM_PNT-ERG Sterile alpha motif (SAM)/Pointed domain of ERG transcription factor. SAM Pointed domain of ERG subfamily of ETS transcriptional regulators is a putative protein-protein interaction domain. It may participate in formation of homodimers or heterodimers with ETS-2, Fli-1, ER81, and Pu-1. However, dimeric forms are inactive and SAM Pointed domain is not essential for dimerization, since ER81 and Pu-1 do not have it. In mouse, a regulator of this type binds the ESET histone H3-specific methyltransferase (human homolog is SETDB1), followed by modification of local chromatin structure through histone methylation.  ERG regulators are involved in endothelial cell differentiation, bone morphogenesis and neural crest development. The Erg gene is a proto-oncogene. It is a target of chromosomal translocations resulting in fusions with new neighboring genes. Chimeric proteins were found in solid tumors such as myeloid leukemia or Ewing's sarcoma. Members of this subfamily are po
Probab=30.61  E-value=28  Score=25.70  Aligned_cols=14  Identities=29%  Similarity=0.297  Sum_probs=12.0

Q ss_pred             cccHHHHHhhhccc
Q 029519           79 MMTLEDFLAKAGAV   92 (192)
Q Consensus        79 eMTLEDFLvKAGvv   92 (192)
                      .||.|||+.+|+..
T Consensus        44 ~LskedF~~~ap~~   57 (75)
T cd08540          44 KMTKDDFQRLTPSY   57 (75)
T ss_pred             hCCHHHHHHHcCCC
Confidence            69999999998643


No 15 
>cd08532 SAM_PNT-PDEF-like Sterile alpha motif (SAM)/Pointed domain of prostate-derived ETS factor. SAM Pointed domain of PDEF-like (Prostate-Derived ETS Factor) subfamily of ETS transcriptional regulators is a putative protein-protein interaction domain. In human males this activator is highly expressed in the prostate gland and enhances androgen-mediated activation of the PSA promoter though interaction with the DNA binding domain of androgen receptor. PDEF may play a role in prostate cancer development as well as in goblet cell formation and mucus production in the epithelial lining of respiratory and intestinal tracts.
Probab=30.46  E-value=28  Score=25.71  Aligned_cols=41  Identities=17%  Similarity=0.044  Sum_probs=23.0

Q ss_pred             CCCCCHHHHHHHHHhCcccc-hh-hhhhc------c-cccHHHHHhhhcc
Q 029519           51 GAMKSVDDVWREIVSGEKKE-MK-EEAID------E-MMTLEDFLAKAGA   91 (192)
Q Consensus        51 lskKTVDEVWrdIq~~~~~~-~~-~~~~~------~-eMTLEDFLvKAGv   91 (192)
                      ..-=|.+.|+.=++-....- -. ....+      . .||.|||+.++..
T Consensus        10 P~~Ws~~~V~~WL~w~~~ef~L~~~~~~F~mnG~~LC~ls~edF~~r~p~   59 (76)
T cd08532          10 PYQWSPANVQKWLLWTEHQYRLPPPPRCFELNGKDLCALSEEDFRRRAPQ   59 (76)
T ss_pred             hhhcCHHHHHHHHHHHHHHhCCCCchhcCCCCHHHHHcCCHHHHHHHcCC
Confidence            34457788877666432110 00 11101      1 6999999999864


No 16 
>cd08534 SAM_PNT-GABP-alpha Sterile alpha motif (SAM)/Pointed domain of GA-binding protein alpha chain. SAM Pointed domain of GABP-alpha subfamily of ETS transcriptional regulators is a putative protein-protein interaction domain. This type of transcriptional regulators forms heterotetramers containing two alpha and two beta subunits.  It interacts with GA repeats (purine rich repeats). GABP transcriptional factors control gene expression in cell cycle control, apoptosis, and cellular respiration. GABP participates in regulation of transmembrane receptors and key hormones especially in myeloid cells and at the neuromuscular junction.
Probab=28.10  E-value=32  Score=26.17  Aligned_cols=44  Identities=18%  Similarity=0.167  Sum_probs=25.1

Q ss_pred             CCCCCCCCHHHHHHHHHhCccc----c--hhhhhhc---c-cccHHHHHhhhcc
Q 029519           48 VSAGAMKSVDDVWREIVSGEKK----E--MKEEAID---E-MMTLEDFLAKAGA   91 (192)
Q Consensus        48 ~~~lskKTVDEVWrdIq~~~~~----~--~~~~~~~---~-eMTLEDFLvKAGv   91 (192)
                      |....-=|-+.||.=++-..+.    .  ...-...   . .||.|||+.++..
T Consensus        16 P~DP~~Wt~~~V~~WL~Wa~~ef~L~~v~~~~F~m~Gk~LC~Ls~edF~~r~p~   69 (89)
T cd08534          16 PYDPMEWTEDQVLHWVVWAVKEFSLTDIDLSDWNITGRELCSLTQEEFFQRVPK   69 (89)
T ss_pred             CCChHHcCHHHHHHHHHHHHHHcCCCCCChhhcCCCHHHHhcCCHHHHHHHcCC
Confidence            4445556778887766643211    0  0000001   1 6999999999874


No 17 
>cd08535 SAM_PNT-Tel_Yan Sterile alpha motif (SAM)/Pointed domain of Tel/Yan protein. SAM Pointed domain of Tel (Translocation, Ets, Leukemia)/Yan subfamily of ETS transcriptional repressors is a protein-protein interaction domain. SAM Pointed domains of this type of regulators can interact with each other, forming head-to-tail homodimers or homooligomers, and/or interact with SAM Pointed domains of another subfamily of ETS factors forming heterodimers. The oligomeric form is able to block transcription of target genesand is involved in MAPK signaling. They participate in regulation of different processes during embryo development including hematopoietic differentiation and eye development. Tel/Yan transcriptional factors are frequent targets of chromosomal translocations resulting in fusions of SAM domain with new neighboring genes. Such chimeric proteins were found in different tumors. Members of this subfamily are potential targets for cancer therapy.
Probab=27.11  E-value=34  Score=24.69  Aligned_cols=12  Identities=33%  Similarity=0.531  Sum_probs=10.8

Q ss_pred             cccHHHHHhhhc
Q 029519           79 MMTLEDFLAKAG   90 (192)
Q Consensus        79 eMTLEDFLvKAG   90 (192)
                      .||.|||+.++.
T Consensus        41 ~ls~edF~~r~p   52 (68)
T cd08535          41 LLTKEDFRYRSP   52 (68)
T ss_pred             cCCHHHHhhhCC
Confidence            699999999875


No 18 
>cd08536 SAM_PNT-Mae Sterile alpha motif (SAM)/Pointed domain of Mae protein homolog. Mae (Modulator of the Activity of ETS) subfamily represents a group of SAM Pointed monodomain proteins. SAM Pointed domain is a protein-protein interaction domain. It can interact with other SAM pointed domains forming head-to-tail heterodimers and also provides a kinase docking site. For example, in Drosophila Mae is required for facilitating phosphorylation of the Yan factor and for blocking phosphorylation of the ETS-2 regulator. Mae interacts with the SAM Pointed domains of Yan and ETS-2. Binding enhances access of the kinase to the Yan phosphorylation site by providing a kinase docking site, or inhibits phosphorylation of ETS-2 by blocking its docking site. This type of factors participates in regulation of kinase signaling particularly during embryogenesis.
Probab=26.94  E-value=34  Score=24.54  Aligned_cols=13  Identities=38%  Similarity=0.677  Sum_probs=10.9

Q ss_pred             cccHHHHHhhhcc
Q 029519           79 MMTLEDFLAKAGA   91 (192)
Q Consensus        79 eMTLEDFLvKAGv   91 (192)
                      .||.|||+.|+..
T Consensus        40 ~ls~edF~~r~P~   52 (66)
T cd08536          40 LMSLEGFLYRVPV   52 (66)
T ss_pred             cCCHHHHHhhcCC
Confidence            6999999998743


No 19 
>cd08538 SAM_PNT-ESE-2-like Sterile alpha motif (SAM)/Pointed domain of ESE-2 like ETS transcriptional regulators. SAM Pointed domain of ESE-2-like (Epithelium-Specific ETS) subfamily of ETS transcriptional regulators is a putative protein-protein interaction domain. It can act as a major transactivator by providing a potential docking site for co-activators. ESE-2 factors are involved in regulation of gene expression in a variety of epithelial (glandular and secretory) cells. ESE-2 mRNA was found in skin keratinocytes, salivary gland, mammary gland, stomach, prostate, and kidneys. The DNA binding consensus motif for ESE-2 consists of a GGA core and AT-rich flanks. The expression profiles of these factors are altered in epithelial cancers. Members of this subfamily are potential targets for cancer therapy.
Probab=26.45  E-value=36  Score=25.45  Aligned_cols=14  Identities=43%  Similarity=0.660  Sum_probs=12.1

Q ss_pred             cccHHHHHhhhccc
Q 029519           79 MMTLEDFLAKAGAV   92 (192)
Q Consensus        79 eMTLEDFLvKAGvv   92 (192)
                      .||.|||+-+|+..
T Consensus        47 ~ms~eeF~~~~p~~   60 (78)
T cd08538          47 SMTQEEFIEAAGIC   60 (78)
T ss_pred             cCCHHHHHHHcccc
Confidence            69999999999843


No 20 
>smart00251 SAM_PNT SAM / Pointed domain. A subfamily of the SAM domain
Probab=26.40  E-value=36  Score=25.14  Aligned_cols=41  Identities=20%  Similarity=0.186  Sum_probs=24.2

Q ss_pred             CCCCCCHHHHHHHHHhCccc----c--hhhhhhc----ccccHHHHHhhhc
Q 029519           50 AGAMKSVDDVWREIVSGEKK----E--MKEEAID----EMMTLEDFLAKAG   90 (192)
Q Consensus        50 ~lskKTVDEVWrdIq~~~~~----~--~~~~~~~----~eMTLEDFLvKAG   90 (192)
                      ...-=|.++|+.=|+-....    .  ...-...    -.||.|||+.+++
T Consensus        16 dP~~Wt~~~V~~Wl~w~~~ef~L~~~~~~~f~m~G~~Lc~ls~edF~~~~p   66 (82)
T smart00251       16 DPQLWTEDHVLEWLEWAVKEFSLSPIDFSKFDMSGKELCSMSKEEFLERAP   66 (82)
T ss_pred             ChhhCCHHHHHHHHHHHHHhcCCCCCCcccCCCCHHHHHcCCHHHHHHHcC
Confidence            44456788888877654211    0  0000001    1699999999997


No 21 
>PF09279 EF-hand_like:  Phosphoinositide-specific phospholipase C, efhand-like;  InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C. It adopts a structure consisting of a core of four alpha helices, in an EF like fold, and is required for functioning of the enzyme []. ; PDB: 3OHM_B 3QR0_A 2ZKM_X 2FJU_B 3QR1_D 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B ....
Probab=25.75  E-value=59  Score=22.83  Aligned_cols=10  Identities=20%  Similarity=0.720  Sum_probs=7.4

Q ss_pred             HHHHHHHHHh
Q 029519           56 VDDVWREIVS   65 (192)
Q Consensus        56 VDEVWrdIq~   65 (192)
                      |++||+.+-.
T Consensus         2 i~~if~~ys~   11 (83)
T PF09279_consen    2 IEEIFRKYSS   11 (83)
T ss_dssp             HHHHHHHHCT
T ss_pred             HHHHHHHHhC
Confidence            6788988833


No 22 
>PF02187 GAS2:  Growth-Arrest-Specific Protein 2 Domain;  InterPro: IPR003108 The growth-arrest-specific protein 2 domain is found associated with the spectrin repeat, calponin homology domain and EF hand in many proteins. It is found among others in the growth arrest-specific protein 2 [].; GO: 0007050 cell cycle arrest; PDB: 1V5R_A.
Probab=25.20  E-value=38  Score=25.18  Aligned_cols=11  Identities=45%  Similarity=0.607  Sum_probs=9.4

Q ss_pred             cccHHHHHhhh
Q 029519           79 MMTLEDFLAKA   89 (192)
Q Consensus        79 eMTLEDFLvKA   89 (192)
                      =+|||+||.|-
T Consensus        56 W~tL~~~L~kh   66 (73)
T PF02187_consen   56 WDTLEEYLDKH   66 (73)
T ss_dssp             EEEHHHHHHHH
T ss_pred             HHHHHHHhhcc
Confidence            49999999874


No 23 
>cd08542 SAM_PNT-ETS-1 Sterile alpha motif (SAM)/Pointed domain of ETS-1. SAM Pointed domain of ETS-1 subfamily of ETS transcriptional activators is a protein-protein interaction domain. The ETS-1 activator is regulated by phosphorylation. It contains a docking site for the ERK2 MAP (Mitogen Activated Protein) kinase, while the ERK2 phosphorylation site is located in the N-terminal disordered region upstream of the SAM Pointed domain. Mutations of the kinase docking site residues inhibit phosphorylation. ETS-1 activators play role in a number of different physiological processes, and they are expressed during embryonic development, including blood vessel formation, hematopoietic, lymphoid, neuronal and osteogenic differentiation. The Ets-1 gene is a proto-oncogene involved in progression of different tumors (including breast cancer, meningioma, and prostate cancer). Members of this subfamily are potential molecular targets for selective cancer therapy.
Probab=25.05  E-value=39  Score=25.80  Aligned_cols=45  Identities=13%  Similarity=0.020  Sum_probs=25.5

Q ss_pred             CCCCCCCCCHHHHHHHHHhCcc----cch--hhhhhc---c-cccHHHHHhhhcc
Q 029519           47 AVSAGAMKSVDDVWREIVSGEK----KEM--KEEAID---E-MMTLEDFLAKAGA   91 (192)
Q Consensus        47 ~~~~lskKTVDEVWrdIq~~~~----~~~--~~~~~~---~-eMTLEDFLvKAGv   91 (192)
                      +|....-=|.+.||.=++-...    .+.  ..=...   . .||.||||.++..
T Consensus        15 Ip~DP~~Wt~~~V~~WL~Wa~~ef~L~~i~~~~F~m~Gk~LC~Ls~edF~~~~P~   69 (88)
T cd08542          15 IPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKECFLELAPD   69 (88)
T ss_pred             CCCChhhCCHHHHHHHHHHHHHHcCCCCCCcccCCCCHHHHHcCCHHHHHhHcCC
Confidence            3445566788899866654311    110  000011   2 6999999999853


No 24 
>PF01475 FUR:  Ferric uptake regulator family;  InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins. These are responsible for controlling the intracellular concentration of iron in many bacteria. Although iron is essential for most organisms, high concentrations can be toxic because of the formation of hydroxyl radicals []. FURs can also control zinc homeostasis [] and is the subject of research on the pathogenesis of mycobacteria.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 1MZB_A 2RGV_B 2FE3_B 3F8N_B 3EYY_B 2W57_A 2FU4_A 2O03_A 3MWM_B 2XIG_B ....
Probab=24.75  E-value=79  Score=23.70  Aligned_cols=38  Identities=16%  Similarity=0.284  Sum_probs=22.7

Q ss_pred             CCCHHHHHHHHHhCcccchhhhhhcccccHHHHHhhhccccc
Q 029519           53 MKSVDDVWREIVSGEKKEMKEEAIDEMMTLEDFLAKAGAVED   94 (192)
Q Consensus        53 kKTVDEVWrdIq~~~~~~~~~~~~~~eMTLEDFLvKAGvv~e   94 (192)
                      --|++|||+.+......=..   .+-==|| |+|+++|++..
T Consensus        23 ~~ta~ei~~~l~~~~~~is~---~TVYR~L-~~L~e~Gli~~   60 (120)
T PF01475_consen   23 HLTAEEIYDKLRKKGPRISL---ATVYRTL-DLLEEAGLIRK   60 (120)
T ss_dssp             SEEHHHHHHHHHHTTTT--H---HHHHHHH-HHHHHTTSEEE
T ss_pred             CCCHHHHHHHhhhccCCcCH---HHHHHHH-HHHHHCCeEEE
Confidence            35899999999854322000   0001123 78999999965


No 25 
>PF04450 BSP:  Peptidase of plants and bacteria;  InterPro: IPR007541 These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens [].
Probab=24.23  E-value=35  Score=29.32  Aligned_cols=14  Identities=36%  Similarity=0.582  Sum_probs=11.0

Q ss_pred             CCCCCCCHHHHHHH
Q 029519           49 SAGAMKSVDDVWRE   62 (192)
Q Consensus        49 ~~lskKTVDEVWrd   62 (192)
                      ..+.+|+|||+|+|
T Consensus       191 ~~l~G~~v~~LW~e  204 (205)
T PF04450_consen  191 KELLGKPVDELWAE  204 (205)
T ss_pred             HHHHCcCHHHHHhh
Confidence            45678888888876


No 26 
>cd08541 SAM_PNT-FLI-1 Sterile alpha motif (SAM)/Pointed domain of friend leukemia integration 1 transcription activator. SAM Pointed domain of FLI-1 (Friend Leukemia Integration) subfamily of ETS transcriptional regulators is a putative protein-protein interaction domain. The FLI-1 protein participates in regulation of cellular differentiation, proliferation, and survival. The Fli-1 gene was initially described in Friend virus-induced erythroleukemias as a site for virus integration. It is highly expressed in hematopoietic tissues and at lower level in lungs, heart, and ovaries. Fli-1 is a proto-oncogene implicated in Ewing's sarcoma and erythroleukemia. Members of this subfamily are potential targets for cancer therapy.
Probab=24.12  E-value=45  Score=25.62  Aligned_cols=46  Identities=20%  Similarity=0.180  Sum_probs=27.3

Q ss_pred             CCCCCCCCCHHHHHHHHHhCccc----c--hhh-hhhcc----cccHHHHHhhhccc
Q 029519           47 AVSAGAMKSVDDVWREIVSGEKK----E--MKE-EAIDE----MMTLEDFLAKAGAV   92 (192)
Q Consensus        47 ~~~~lskKTVDEVWrdIq~~~~~----~--~~~-~~~~~----eMTLEDFLvKAGvv   92 (192)
                      +|....-=|.++||.=++-..+.    +  ... ....+    .||-|||+.+++..
T Consensus        13 IP~DP~~Wt~~hV~~WL~Wa~~ef~L~~vd~~~F~~m~Gk~LC~LskedF~~~~p~~   69 (91)
T cd08541          13 VPADPTLWTQEHVRQWLEWAIKEYGLMEIDTSFFQNMDGKELCKMNKEDFLRATSLY   69 (91)
T ss_pred             CCCChhhcCHHHHHHHHHHHHHHcCCCCCChhhccCCCHHHHHhCCHHHHHHHcCCC
Confidence            45566667889998766643211    1  000 00111    69999999998654


No 27 
>KOG3330 consensus Transport protein particle (TRAPP) complex subunit [Intracellular trafficking, secretion, and vesicular transport]
Probab=22.89  E-value=43  Score=28.75  Aligned_cols=13  Identities=46%  Similarity=0.682  Sum_probs=10.9

Q ss_pred             cHHHHHhhhcccc
Q 029519           81 TLEDFLAKAGAVE   93 (192)
Q Consensus        81 TLEDFLvKAGvv~   93 (192)
                      -.||||+|++|-+
T Consensus        57 LiedFLAks~vpR   69 (183)
T KOG3330|consen   57 LIEDFLAKSNVPR   69 (183)
T ss_pred             HHHHHHhhcCCch
Confidence            4699999999874


No 28 
>PF03698 UPF0180:  Uncharacterised protein family (UPF0180);  InterPro: IPR005370 The members of this family are small uncharacterised proteins.
Probab=22.23  E-value=69  Score=24.01  Aligned_cols=17  Identities=6%  Similarity=0.157  Sum_probs=14.4

Q ss_pred             CCCCCCCHHHHHHHHHh
Q 029519           49 SAGAMKSVDDVWREIVS   65 (192)
Q Consensus        49 ~~lskKTVDEVWrdIq~   65 (192)
                      -.++++|.|||+.+|..
T Consensus        61 InA~G~T~eEI~~~v~~   77 (80)
T PF03698_consen   61 INASGLTAEEIVQEVEE   77 (80)
T ss_pred             EecCCCCHHHHHHHHHH
Confidence            56799999999998853


No 29 
>TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR. This model describes IscR, an iron-sulfur binding transcription factor of the ISC iron-sulfur cluster assembly system.
Probab=21.07  E-value=59  Score=25.27  Aligned_cols=32  Identities=16%  Similarity=0.337  Sum_probs=21.1

Q ss_pred             CCCHHHHHHHHHhCcccchhhhhhcccccHHHHHhhhc
Q 029519           53 MKSVDDVWREIVSGEKKEMKEEAIDEMMTLEDFLAKAG   90 (192)
Q Consensus        53 kKTVDEVWrdIq~~~~~~~~~~~~~~eMTLEDFLvKAG   90 (192)
                      .-.+..+|.+++..-.      .....+||+|++.+..
T Consensus       103 ~c~~~~~~~~~~~~~~------~~L~~~TL~dl~~~~~  134 (135)
T TIGR02010       103 RCLTHDLWADLSKHIR------DYLESISLADLVNQQN  134 (135)
T ss_pred             CccHHHHHHHHHHHHH------HHHhcCcHHHHHhhcc
Confidence            3346789998876521      1134799999986543


No 30 
>KOG3170 consensus Conserved phosducin-like protein [Signal transduction mechanisms]
Probab=21.04  E-value=64  Score=28.83  Aligned_cols=16  Identities=50%  Similarity=0.810  Sum_probs=12.6

Q ss_pred             ccHHHHHhhhc-ccccc
Q 029519           80 MTLEDFLAKAG-AVEDS   95 (192)
Q Consensus        80 MTLEDFLvKAG-vv~e~   95 (192)
                      -.||+||++|| ++++.
T Consensus       191 ed~e~~L~qaga~l~d~  207 (240)
T KOG3170|consen  191 EDVEDFLVQAGAALTDG  207 (240)
T ss_pred             HHHHHHHHhcccccccc
Confidence            45899999999 66654


No 31 
>PF00727 IL4:  Interleukin 4 This family is a subset of the SCOP family;  InterPro: IPR002354 Cytokines are protein messengers that carry information from cell to cell []. Interleukin is one such molecule, and participates in several B-cell activation processes: e.g., it enhances production and secretion of IgG1 and IgE []; it induces expression of class II major histocompatability complex (MHC) molecules on resting B-cells; and it regulates expression of the low affinity Fc receptor for IgE on lymphocytes and monocytes. Interleukin-4 (IL4) has a compact, globular fold (similar to other cytokines), stabilised by 3 disulphide bonds []. One half of the structure is dominated by a 4 alpha-helix bundle with a left-handed twist []. The helices are anti-parallel, with 2 overhand connections, which fall into a 2-stranded anti-parallel beta-sheet [].; GO: 0005136 interleukin-4 receptor binding, 0008083 growth factor activity, 0006955 immune response, 0005576 extracellular region; PDB: 1HIK_A 1HZI_A 1ITI_A 2INT_A 1RCB_A 1CYL_A 3QB7_A 1BBN_A 2B8Z_A 1ITM_A ....
Probab=21.02  E-value=49  Score=26.61  Aligned_cols=12  Identities=42%  Similarity=0.617  Sum_probs=10.1

Q ss_pred             cccHHHHHhhhc
Q 029519           79 MMTLEDFLAKAG   90 (192)
Q Consensus        79 eMTLEDFLvKAG   90 (192)
                      ..||+|||.+-.
T Consensus        98 ~ttLkdFLe~Lk  109 (117)
T PF00727_consen   98 QTTLKDFLERLK  109 (117)
T ss_dssp             EEEHHHHHHHHH
T ss_pred             hhhHHHHHHHHH
Confidence            699999998754


No 32 
>PF12221 HflK_N:  Bacterial membrane protein N terminal;  InterPro: IPR020980  HflK is a bacterial membrane protein which is thought, together with the HflC protein, to form a membrane protease complex whose activity is modulated by the GTPase HflX []. This entry represents the N-terminal, membrane-spanning, region of of HflK responsible for anchoring the protein in the bacterial membrane. It is often found in association with PF01145 from PFAM.
Probab=20.47  E-value=66  Score=21.40  Aligned_cols=11  Identities=18%  Similarity=0.691  Sum_probs=9.4

Q ss_pred             CHHHHHHHHHh
Q 029519           55 SVDDVWREIVS   65 (192)
Q Consensus        55 TVDEVWrdIq~   65 (192)
                      -.|||||.++.
T Consensus        22 DLdel~r~l~~   32 (42)
T PF12221_consen   22 DLDELFRKLQD   32 (42)
T ss_pred             CHHHHHHHHHH
Confidence            46999999986


No 33 
>cd04405 RhoGAP_BRCC3-like RhoGAP_BRCC3-like: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of BRCC3-like proteins. This subgroup also contains two groups of closely related proteins, BRCC3 and DEPDC7, which both contain a C-terminal RhoGAP-like domain and an N-terminal DEP (Disheveled, Egl-10, and Pleckstrin) domain. The function(s) of  BRCC3 and DEPDC7 are unknown. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=20.37  E-value=43  Score=29.85  Aligned_cols=16  Identities=19%  Similarity=0.385  Sum_probs=12.2

Q ss_pred             CCCCCHHHHHHHHHhC
Q 029519           51 GAMKSVDDVWREIVSG   66 (192)
Q Consensus        51 lskKTVDEVWrdIq~~   66 (192)
                      ++.+-|+|||+++--.
T Consensus         1 ls~~~v~evW~~~tl~   16 (235)
T cd04405           1 LSPEVVEEIWKEQTLI   16 (235)
T ss_pred             CCHHHHHHHHHHHHHH
Confidence            3456799999998754


Done!