Citrus Sinensis ID: 029524

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--

MATEGEAVTEQQPAAEEPEKVVTEKKAKAAKEKKPKAPKEKKPKQSKTPSHPPYFQMITEALMALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGNLIKIRASYKLSEAAAGKTKKEIKTKAKAPRKTRSVTAAAKIKAESAAAAPPPPKKAKKSAAAKPKQPKSIKSPAAKKAKKAAAQ

cccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccc

******************************************************FQMITEALMALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGNLIKIRASYKL**************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MATEGEAVTEQQPAAEEPEKVVTEKKAKAAKEKKPKAPKEKKPKQSKTPSHPPYFQMITEALMALQDKSGSSPYAIAKYMEEKHKDELPANFRKILAVQLKHFAAKGNLIKIRASYKLSEAAAGKTKKEIKTKAKAPRKTRSVTAAAKIKAESAAAAPPPPKKAKKSAAAKPKQPKSIKSPAAKKAKKAAAQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Histone H1	Histones H1 are necessary for the condensation of nucleosome chains into higher order structures.	probable	P40267

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1USS, chain A
Confidence level:confident
Coverage over the Query: 47-125
View the alignment between query and template
View the model in PyMOL