Citrus Sinensis ID: 029536

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MMTSPDEAQFFSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDVSSTKEKYHGTFDFVFVDADKDNYVNYHKRLIELVKVGGVIGYDNTLWGGSVVAPPDADLDEHFLYLRDFVQELNKALAVDPRIEICQISIADGVTLCRRIG
ccccHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHccccccEEEECcccHHHHHHHHHcHHcccccccccccEEEEEccccccHHHHHHHHccccccCEEEEcccccccCEccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEccccEEEEEEcc
**TSPDEAQFFSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDVSSTKEKYHGTFDFVFVDADKDNYVNYHKRLIELVKVGGVIGYDNTLWGGSVVAPPDADLDEHFLYLRDFVQELNKALAVDPRIEICQISIADGVTLCRRIG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMTSPDEAQFFSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDVSSTKEKYHGTFDFVFVDADKDNYVNYHKRLIELVKVGGVIGYDNTLWGGSVVAPPDADLDEHFLYLRDFVQELNKALAVDPRIEICQISIADGVTLCRRIG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Caffeoyl-CoA O-methyltransferase 1 Methylates caffeoyl-CoA to feruloyl-CoA and 5-hydroxyferuloyl-CoA to sinapoyl-CoA. Plays a role in the synthesis of feruloylated polysaccharides. Involved in the reinforcement of the plant cell wall. Also involved in the responding to wounding or pathogen challenge by the increased formation of cell wall-bound ferulic acid polymers.probableO49499
Caffeoyl-CoA O-methyltransferase 1 Methylates caffeoyl-CoA to feruloyl-CoA and 5-hydroxyferuloyl-CoA to sinapoyl-CoA. Plays a role in the synthesis of feruloylated polysaccharides. Involved in the reinforcement of the plant cell wall. Also involved in the responding to wounding or pathogen challenge by the increased formation of cell wall-bound ferulic acid polymers.probableO65862
Caffeoyl-CoA O-methyltransferase Methylates caffeoyl-CoA to feruloyl-CoA and 5-hydroxyferuloyl-CoA to sinapoyl-CoA. Plays a role in the synthesis of feruloylated polysaccharides. Involved in the reinforcement of the plant cell wall. Also involved in the responding to wounding or pathogen challenge by the increased formation of cell wall-bound ferulic acid polymers.probableQ9SLP8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.104Caffeoyl-CoA O-methyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SUI, chain A
Confidence level:very confident
Coverage over the Query: 1-191
View the alignment between query and template
View the model in PyMOL