BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029537
         (192 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2BIE|A Chain A, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure H)
 pdb|2BIE|B Chain B, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure H)
 pdb|2BIG|A Chain A, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure I)
 pdb|2BIG|B Chain B, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure I)
          Length = 361

 Score = 33.1 bits (74), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 17  SLPDINAFRIGLREWRSKLNCITNPYIY----KQLLEINSVDLIAKGNSDISSRQSAANK 72
           S+PD + F+  L E  + L+  +N  IY    +   EIN   LIA  +SDI SR    N+
Sbjct: 130 SIPDFSEFQ--LNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQ 187

Query: 73  F 73
           F
Sbjct: 188 F 188


>pdb|1W23|A Chain A, Crystal Structure Of Phosphoserine Aminotransferase From
           Bacillus Alcalophilus
 pdb|1W23|B Chain B, Crystal Structure Of Phosphoserine Aminotransferase From
           Bacillus Alcalophilus
 pdb|2BHX|A Chain A, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure A)
 pdb|2BHX|B Chain B, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure A)
 pdb|2BI1|A Chain A, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure B)
 pdb|2BI1|B Chain B, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure B)
 pdb|2BI2|A Chain A, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure C)
 pdb|2BI2|B Chain B, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure C)
 pdb|2BI3|A Chain A, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure D)
 pdb|2BI3|B Chain B, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure D)
 pdb|2BI5|A Chain A, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure E)
 pdb|2BI5|B Chain B, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure E)
 pdb|2BI9|A Chain A, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure F)
 pdb|2BI9|B Chain B, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure F)
 pdb|2BIA|A Chain A, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure G)
 pdb|2BIA|B Chain B, Radiation Damage Of The Schiff Base In Phosphoserine
           Aminotransferase (Structure G)
          Length = 360

 Score = 33.1 bits (74), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 17  SLPDINAFRIGLREWRSKLNCITNPYIY----KQLLEINSVDLIAKGNSDISSRQSAANK 72
           S+PD + F+  L E  + L+  +N  IY    +   EIN   LIA  +SDI SR    N+
Sbjct: 129 SIPDFSEFQ--LNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQ 186

Query: 73  F 73
           F
Sbjct: 187 F 187


>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In
           Complex With The Bisindoylmaleide Inhibitor Bim Viii
 pdb|2VD5|B Chain B, Structure Of Human Myotonic Dystrophy Protein Kinase In
           Complex With The Bisindoylmaleide Inhibitor Bim Viii
          Length = 412

 Score = 28.9 bits (63), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 16/74 (21%)

Query: 42  YIYKQLLEINSVDLIAKGNSDISSRQSAANKFLDKVFRVRLGRGFYGECLGVRADGN--- 98
           Y+ + ++ I+SV  +   + DI       N  LD+   +RL    +G CL +RADG    
Sbjct: 167 YLAEIVMAIDSVHRLGYVHRDIKPD----NILLDRCGHIRLAD--FGSCLKLRADGTVRS 220

Query: 99  -------SYLSDEI 105
                   YLS EI
Sbjct: 221 LVAVGTPDYLSPEI 234


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.135    0.406 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,196,893
Number of Sequences: 62578
Number of extensions: 173454
Number of successful extensions: 317
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 315
Number of HSP's gapped (non-prelim): 6
length of query: 192
length of database: 14,973,337
effective HSP length: 93
effective length of query: 99
effective length of database: 9,153,583
effective search space: 906204717
effective search space used: 906204717
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 49 (23.5 bits)