Citrus Sinensis ID: 029545


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MRGSSSVILRRLLVRRQVLNPNSTNIAKSLISHSTNNTTVPKIPSFRNYIPASSSQSQSQMLPSLQFHRTLFSSPDGPSNILVIESGEEFNSSLGKVKDDSLPAIFYFTAAWCGPCKFIWPVIGELSAKHPHVTTYKIDIDQKGLESTLSKLNISAVPTFLFFQHGEKVAEIVGADVSRLKTTMEQLYKKD
cccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHcccccccEEEEEEccEEEEEEEcccHHHHHHHHHHHHHcc
******VILRRLLVRRQVLN************************************************************ILVIESGEEFNSSLGKVKDDSLPAIFYFTAAWCGPCKFIWPVIGELSAKHPHVTTYKIDIDQKGLESTLSKLNISAVPTFLFFQHGEKVAEIVGADVSRLKTTMEQLY***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGSSSVILRRLLVRRQVLNPNSTNIAKSLISHSTNNTTVPKIPSFRNYIPASSSQSQSQMLPSLQFHRTLFSSPDGPSNILVIESGEEFNSSLGKVKDDSLPAIFYFTAAWCGPCKFIWPVIGELSAKHPHVTTYKIDIDQKGLESTLSKLNISAVPTFLFFQHGEKVAEIVGADVSRLKTTMEQLYKKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin O1, mitochondrial Thiol-disulfide oxidoreductase that may participate in various redox reactions. Possesses insulin disulfide bonds reducing activity. Reduced by thioredoxin reductases NTRA and NTRB.probableO64764

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 18-190
View the alignment between query and template
View the model in PyMOL