Citrus Sinensis ID: 029545

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-

MRGSSSVILRRLLVRRQVLNPNSTNIAKSLISHSTNNTTVPKIPSFRNYIPASSSQSQSQMLPSLQFHRTLFSSPDGPSNILVIESGEEFNSSLGKVKDDSLPAIFYFTAAWCGPCKFIWPVIGELSAKHPHVTTYKIDIDQKGLESTLSKLNISAVPTFLFFQHGEKVAEIVGADVSRLKTTMEQLYKKD

cccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHcccccccEEEEEEccEEEEEEEcccHHHHHHHHHHHHHcc

******VILRRLLVRRQVLN************************************************************ILVIESGEEFNSSLGKVKDDSLPAIFYFTAAWCGPCKFIWPVIGELSAKHPHVTTYKIDIDQKGLESTLSKLNISAVPTFLFFQHGEKVAEIVGADVSRLKTTMEQLY***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRGSSSVILRRLLVRRQVLNPNSTNIAKSLISHSTNNTTVPKIPSFRNYIPASSSQSQSQMLPSLQFHRTLFSSPDGPSNILVIESGEEFNSSLGKVKDDSLPAIFYFTAAWCGPCKFIWPVIGELSAKHPHVTTYKIDIDQKGLESTLSKLNISAVPTFLFFQHGEKVAEIVGADVSRLKTTMEQLYKKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Thioredoxin O1, mitochondrial	Thiol-disulfide oxidoreductase that may participate in various redox reactions. Possesses insulin disulfide bonds reducing activity. Reduced by thioredoxin reductases NTRA and NTRB.	probable	O64764

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 18-190
View the alignment between query and template
View the model in PyMOL