Query         029551
Match_columns 191
No_of_seqs    35 out of 37
Neff          2.6 
Searched_HMMs 46136
Date          Fri Mar 29 14:43:48 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/029551.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/029551hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1698 Mitochondrial/chloropl  99.8 1.5E-19 3.3E-24  153.1   8.3  129   40-184     4-138 (201)
  2 TIGR01024 rplS_bact ribosomal   99.1 1.5E-10 3.4E-15   90.7   6.5   55  125-184     3-61  (113)
  3 PRK05338 rplS 50S ribosomal pr  99.1 3.1E-10 6.7E-15   89.3   6.9   56  124-184     2-61  (116)
  4 CHL00084 rpl19 ribosomal prote  99.0 2.1E-09 4.5E-14   84.9   7.1   58  122-184     4-65  (117)
  5 PF01245 Ribosomal_L19:  Riboso  98.9 1.9E-09 4.2E-14   84.0   6.5   51  134-184     7-61  (113)
  6 COG0335 RplS Ribosomal protein  98.3 1.8E-06   4E-11   68.7   7.0   56  124-184     4-63  (115)
  7 PF09926 DUF2158:  Uncharacteri  79.3     1.2 2.6E-05   31.0   1.5   28  146-173     1-35  (53)
  8 PF12969 DUF3857:  Domain of Un  74.9     2.4 5.1E-05   32.3   2.1   22  141-162    85-106 (177)
  9 PF05641 Agenet:  Agenet domain  67.3      17 0.00036   25.3   4.9   42  146-189     1-42  (68)
 10 TIGR01352 tonB_Cterm TonB fami  65.8      15 0.00033   24.2   4.3   33  127-159    36-68  (74)
 11 PF10447 EXOSC1:  Exosome compo  64.9     4.6 9.9E-05   30.2   1.8   32  125-156    46-79  (82)
 12 KOG3409 Exosomal 3'-5' exoribo  62.4     3.5 7.6E-05   35.9   0.9   34  125-158   100-135 (193)
 13 cd01288 FabZ FabZ is a 17kD be  58.9      21 0.00046   25.8   4.3   29  142-170    84-112 (131)
 14 PHA03171 UL37 tegument protein  53.1     8.7 0.00019   37.3   1.9   41   97-138    96-136 (499)
 15 cd03440 hot_dog The hotdog fol  52.4      42  0.0009   19.9   4.3   46  120-165    18-77  (100)
 16 cd00493 FabA_FabZ FabA/Z, beta  51.7      31 0.00068   24.7   4.2   33  141-173    84-116 (131)
 17 KOG0628 Aromatic-L-amino-acid/  49.6     9.4  0.0002   37.4   1.5   34  119-153     6-40  (511)
 18 COG1499 NMD3 NMD protein affec  47.2      11 0.00025   34.8   1.6   15  142-156   243-257 (355)
 19 PF01472 PUA:  PUA domain;  Int  46.9      32 0.00069   24.1   3.5   29  129-157     5-42  (74)
 20 PF00122 E1-E2_ATPase:  E1-E2 A  46.8      12 0.00025   29.9   1.5   26  142-171    48-73  (230)
 21 cd05791 S1_CSL4 S1_CSL4: CSL4,  45.4      16 0.00035   26.9   2.0   34  126-159    39-74  (92)
 22 PRK04424 fatty acid biosynthes  45.3      42 0.00092   27.5   4.5   56  117-172   101-165 (185)
 23 cd04454 S1_Rrp4_like S1_Rrp4_l  45.2      18  0.0004   25.0   2.1   39  125-163    30-68  (82)
 24 PF06107 DUF951:  Bacterial pro  44.5      14 0.00031   26.6   1.5   17  145-161     1-17  (57)
 25 PF08605 Rad9_Rad53_bind:  Fung  43.3      16 0.00035   29.5   1.8   13  144-156    58-70  (131)
 26 PF13550 Phage-tail_3:  Putativ  42.9      30 0.00065   26.0   3.1   14  144-157   138-151 (164)
 27 KOG3572 Uncharacterized conser  41.4      16 0.00034   40.0   1.8   19  140-158   122-140 (1701)
 28 smart00359 PUA Putative RNA-bi  39.0      78  0.0017   21.1   4.4   25  144-173    29-53  (77)
 29 PRK00006 fabZ (3R)-hydroxymyri  38.3      64  0.0014   24.5   4.3   20  145-164   101-120 (147)
 30 COG0810 TonB Periplasmic prote  36.9      43 0.00093   28.3   3.4   33  127-159   206-238 (244)
 31 KOG3416 Predicted nucleic acid  35.6      21 0.00046   29.7   1.3   11  145-155    61-71  (134)
 32 TIGR01750 fabZ beta-hydroxyacy  35.5      83  0.0018   23.5   4.5   23  141-163    93-115 (140)
 33 COG0250 NusG Transcription ant  34.8      33 0.00071   28.7   2.4   38  124-165   106-153 (178)
 34 TIGR02266 gmx_TIGR02266 Myxoco  34.6 1.4E+02   0.003   20.7   5.2   19  144-162    35-53  (96)
 35 COG0361 InfA Translation initi  34.5      27 0.00059   26.2   1.7   13  145-157    46-58  (75)
 36 PF04970 LRAT:  Lecithin retino  33.6      57  0.0012   24.5   3.3   28  143-177     4-31  (125)
 37 PF02765 POT1:  Telomeric singl  32.9      40 0.00086   26.4   2.4   21  144-164    71-93  (146)
 38 PRK13692 (3R)-hydroxyacyl-ACP   32.8      59  0.0013   26.0   3.5   20  142-161    93-112 (159)
 39 PF05697 Trigger_N:  Bacterial   31.4      38 0.00082   26.1   2.1   22  129-150    27-48  (145)
 40 PRK09521 exosome complex RNA-b  30.9      20 0.00043   29.3   0.5   36  125-160    98-133 (189)
 41 cd05702 S1_Rrp5_repeat_hs11_sc  30.7      59  0.0013   21.9   2.7   17  141-157    42-58  (70)
 42 cd04491 SoSSB_OBF SoSSB_OBF: A  29.6      79  0.0017   21.9   3.3   23  143-165    46-69  (82)
 43 PF02563 Poly_export:  Polysacc  29.6      38 0.00081   24.1   1.7   13  145-157    12-24  (82)
 44 PRK11507 ribosome-associated p  29.6      34 0.00074   25.3   1.5    9  146-154    53-61  (70)
 45 cd00164 S1_like S1_like: Ribos  29.4      43 0.00094   20.5   1.8   15  145-159    41-55  (65)
 46 PRK04163 exosome complex RNA-b  29.0      51  0.0011   28.1   2.7   37  125-161    87-127 (235)
 47 COG1566 EmrA Multidrug resista  28.9      74  0.0016   29.4   3.8   59  123-182   234-294 (352)
 48 cd03442 BFIT_BACH Brown fat-in  28.7 1.1E+02  0.0023   21.4   3.9   25  145-169    63-87  (123)
 49 TIGR00451 unchar_dom_2 unchara  28.7      64  0.0014   23.9   2.9   29  129-157    35-72  (107)
 50 smart00357 CSP Cold shock prot  28.5      89  0.0019   19.7   3.1   18  143-160    34-51  (64)
 51 COG2030 MaoC Acyl dehydratase   28.1      90   0.002   24.7   3.8   29  138-166    99-127 (159)
 52 PF07238 PilZ:  PilZ domain;  I  27.9 1.4E+02   0.003   19.9   4.2   20  145-164    44-63  (102)
 53 cd04497 hPOT1_OB1_like hPOT1_O  27.7      48   0.001   25.8   2.1   15  141-155    64-78  (138)
 54 KOG0494 Transcription factor C  27.6      14  0.0003   34.3  -1.0   45  118-162   140-184 (332)
 55 cd03451 FkbR2 FkbR2 is a Strep  26.5 1.1E+02  0.0025   22.6   3.9   21  143-163    89-109 (146)
 56 cd03692 mtIF2_IVc mtIF2_IVc: t  25.6      42 0.00091   24.0   1.3   11  143-153    73-83  (84)
 57 PF03544 TonB_C:  Gram-negative  25.3      53  0.0012   21.8   1.7   32  128-159    43-74  (79)
 58 TIGR02219 phage_NlpC_fam putat  25.3 1.5E+02  0.0033   22.9   4.5   27  144-174    75-101 (134)
 59 TIGR03684 arCOG00985 arCOG0415  25.2 1.2E+02  0.0026   23.9   4.0   14  144-157    98-111 (150)
 60 PF12945 YcgR_2:  Flagellar pro  25.1      68  0.0015   21.9   2.3   25  146-170     1-27  (87)
 61 PF01191 RNA_pol_Rpb5_C:  RNA p  25.1      44 0.00096   24.8   1.4   11  145-155    48-58  (74)
 62 PF13275 S4_2:  S4 domain; PDB:  25.0      40 0.00086   24.4   1.1   10  145-154    48-57  (65)
 63 PF07703 A2M_N_2:  Alpha-2-macr  24.7 1.4E+02   0.003   21.9   4.0   17  145-161     9-25  (136)
 64 PF09874 DUF2101:  Predicted me  24.6      61  0.0013   28.6   2.4   16  142-157   178-193 (206)
 65 PF11213 DUF3006:  Protein of u  24.4      76  0.0016   22.5   2.5   12  143-154    31-42  (71)
 66 PF12238 MSA-2c:  Merozoite sur  23.6      35 0.00076   29.8   0.7   12  178-191   194-205 (205)
 67 cd03452 MaoC_C MaoC_C  The C-t  23.5 1.1E+02  0.0023   23.5   3.3   22  141-162    84-105 (142)
 68 smart00739 KOW KOW (Kyprides,   23.4      70  0.0015   17.8   1.8   12  145-156     1-12  (28)
 69 COG1096 Predicted RNA-binding   22.2      59  0.0013   28.2   1.8   14  144-157   117-130 (188)
 70 COG0186 RpsQ Ribosomal protein  22.0 1.6E+02  0.0034   22.8   3.9   30  145-174    55-84  (87)
 71 PF14801 GCD14_N:  tRNA methylt  21.8      61  0.0013   23.3   1.5   35  145-188     5-39  (54)
 72 PF13437 HlyD_3:  HlyD family s  21.7 2.3E+02   0.005   19.9   4.5   44  140-185    44-91  (105)
 73 PF02752 Arrestin_C:  Arrestin   21.3 1.7E+02  0.0036   20.7   3.7   22  146-167    16-37  (136)
 74 PF01835 A2M_N:  MG2 domain;  I  21.3      82  0.0018   22.2   2.1   17  145-161    10-26  (99)
 75 PF15493 YrpD:  Domain of unkno  20.9      93   0.002   27.6   2.8   33  142-174    92-126 (208)
 76 COG1813 Predicted transcriptio  20.8      29 0.00063   29.5  -0.3   48  108-155   113-163 (165)
 77 PTZ00274 cytochrome b5 reducta  20.8   1E+02  0.0022   27.6   3.0   11  145-155   136-146 (325)
 78 PRK08916 flagellar motor switc  20.7      89  0.0019   24.9   2.4   32  142-173    62-99  (116)
 79 PRK08559 nusG transcription an  20.6      82  0.0018   25.1   2.2   12  144-155    93-104 (153)
 80 cd04460 S1_RpoE S1_RpoE: RpoE,  20.4 1.5E+02  0.0032   21.5   3.3   33  146-178    54-89  (99)
 81 cd03711 Tet_C Tet_C: C-terminu  20.4      26 0.00055   24.4  -0.6   61  121-188    14-74  (78)
 82 cd05692 S1_RPS1_repeat_hs4 S1_  20.3 1.4E+02  0.0031   18.7   2.9   20  145-164    44-63  (69)
 83 COG1107 Archaea-specific RecJ-  20.2      97  0.0021   31.7   3.1   25  136-160   249-273 (715)
 84 PRK14560 putative RNA-binding   20.0 1.7E+02  0.0036   23.4   3.9   26  144-173   105-130 (160)

No 1  
>KOG1698 consensus Mitochondrial/chloroplast ribosomal protein L19 [Translation, ribosomal structure and biogenesis]
Probab=99.79  E-value=1.5e-19  Score=153.11  Aligned_cols=129  Identities=17%  Similarity=0.107  Sum_probs=100.0

Q ss_pred             cceeeecc---CCCccccceecccccceeEEeeccchhhhcchhhHHHhHHHHhhccccchhhccccchhhhhhhcCCCC
Q 029551           40 HGVSVSAK---PIGWNLGFFVNAQVKDSFVVRAEANEEAEANESIEEEQNEAVQAQGDVVVAVEAESEDKVEEEEVKAPR  116 (191)
Q Consensus        40 srlsls~~---~~s~~~~~~~~~~~k~~fVvrAea~~ea~~~~~~~e~~~E~~~~~~d~v~~~Ege~~~v~eeeE~~~pr  116 (191)
                      ||+++++.   +..|++.+.+.....++|++.+|....+.....+                ..++.-+...-.+..+..+
T Consensus         4 sr~~~~r~~~~~~a~~~~v~l~~~~~~~~~~~~e~~~~a~~~~~~----------------~~~~~~~~~~~~~~~~~f~   67 (201)
T KOG1698|consen    4 SRLGFDRFPMFRAASYRNVSLKGKWFSSFIAISEERCFAPTKRPS----------------VNEPSPESPCVVEQYPEFL   67 (201)
T ss_pred             ceeeeecccccchhhhheeecccceeeeeccccccccccCCCCcc----------------cccCCCCCccccccCcccc
Confidence            34555554   4567777777778889999988774443322220                1233333333344556777


Q ss_pred             CCccchhhHHHHhhHHHHHHhhhcCCCCCCCCCcEEEEEEeeecCCCCcceeeEEEee---ccCCceeEEe
Q 029551          117 KPRVKLGDIMGILNKRAVEASESERPIPDIRTGDVVEIKLFLKIGVGCPFTKVLLCQG---KMLGSTLQFE  184 (191)
Q Consensus       117 kkrkk~g~IM~ILnkeavee~~~~R~iPdiRpGdIVelklEVPEnkRR~~t~~~ic~~---~glgstf~~~  184 (191)
                      +-++..++||++||+++|++.++.|.+|.|++||||+|+.++|+|+|+++.++||||.   +|+++||+.-
T Consensus        68 ~~~~~~~~~~e~Ldr~a~~~rr~~r~iPe~~~G~Iv~V~s~~p~~k~k~s~f~Gi~I~R~~~Gl~atf~LR  138 (201)
T KOG1698|consen   68 PLRKVAKRIMEILDRQAVLERRKVRDIPEFKVGSIVRVTSEDPENKRKVSRFKGICIRRRNAGLNATFLLR  138 (201)
T ss_pred             cchhHHHHHHHhhCHHHHHHHHhcccCCccccccEEEEEecCCccCCceeEEEEEEEEecccCCcceEEee
Confidence            7788899999999999999999999999999999999999999999999999999996   9999999863


No 2  
>TIGR01024 rplS_bact ribosomal protein L19, bacterial type. This model describes bacterial ribosomoal protein L19 and its chloroplast equivalent. Putative mitochondrial L19 are found in several species (but not Saccharomyces cerevisiae) and score between trusted and noise cutoffs.
Probab=99.11  E-value=1.5e-10  Score=90.69  Aligned_cols=55  Identities=15%  Similarity=0.238  Sum_probs=48.2

Q ss_pred             HHHHhhHHHHHHhhhcCCCCCCCCCcEEEEEEeeec-CCCCcceeeEEEee---ccCCceeEEe
Q 029551          125 IMGILNKRAVEASESERPIPDIRTGDVVEIKLFLKI-GVGCPFTKVLLCQG---KMLGSTLQFE  184 (191)
Q Consensus       125 IM~ILnkeavee~~~~R~iPdiRpGdIVelklEVPE-nkRR~~t~~~ic~~---~glgstf~~~  184 (191)
                      +|+.++++.+     .+.+|+|++||+|++.+.++| ||.|.+.|.|+||+   +|++||||.-
T Consensus         3 ~i~~~e~~~~-----~~~ip~f~~GD~v~V~~~i~eg~k~R~q~f~GvvI~~~~~G~~~tftvR   61 (113)
T TIGR01024         3 LIKQIEQEQL-----KKDLPDFRVGDTVRVHVKIVEGKKERIQVFEGVVIARRGGGIGETFTVR   61 (113)
T ss_pred             HHHHHHHHHh-----hcCCCccCCCCEEEEEEEEccCCceEcccEEEEEEEEeCCCCceEEEEE
Confidence            5666666655     578999999999999999999 89999999999997   9999999974


No 3  
>PRK05338 rplS 50S ribosomal protein L19; Provisional
Probab=99.08  E-value=3.1e-10  Score=89.35  Aligned_cols=56  Identities=14%  Similarity=0.221  Sum_probs=48.6

Q ss_pred             hHHHHhhHHHHHHhhhcCCCCCCCCCcEEEEEEeeec-CCCCcceeeEEEee---ccCCceeEEe
Q 029551          124 DIMGILNKRAVEASESERPIPDIRTGDVVEIKLFLKI-GVGCPFTKVLLCQG---KMLGSTLQFE  184 (191)
Q Consensus       124 ~IM~ILnkeavee~~~~R~iPdiRpGdIVelklEVPE-nkRR~~t~~~ic~~---~glgstf~~~  184 (191)
                      .||+.++.+.+     .+.+|+|++||+|++.+.+.| ||.|.+.|.|+||+   +|++||||.-
T Consensus         2 ~~i~~~~~~~~-----~~~~p~f~~GD~V~V~~~i~eg~k~R~q~f~GvvI~~~~~G~~~tftvR   61 (116)
T PRK05338          2 NLIKEIEAEQL-----RKDIPEFRPGDTVRVHVKVVEGNKERIQAFEGVVIARRGRGLNETFTVR   61 (116)
T ss_pred             cHHHHHHHHHh-----hcCCCCcCCCCEEEEEEEEccCCceEeccEEEEEEEEeCCCCCceEEEE
Confidence            36677777766     377999999999999999998 68899999999997   9999999974


No 4  
>CHL00084 rpl19 ribosomal protein L19
Probab=98.95  E-value=2.1e-09  Score=84.91  Aligned_cols=58  Identities=16%  Similarity=0.234  Sum_probs=47.7

Q ss_pred             hhhHHHHhhHHHHHHhhhcCCCCCCCCCcEEEEEEeeec-CCCCcceeeEEEee---ccCCceeEEe
Q 029551          122 LGDIMGILNKRAVEASESERPIPDIRTGDVVEIKLFLKI-GVGCPFTKVLLCQG---KMLGSTLQFE  184 (191)
Q Consensus       122 ~g~IM~ILnkeavee~~~~R~iPdiRpGdIVelklEVPE-nkRR~~t~~~ic~~---~glgstf~~~  184 (191)
                      +..+++-++++.+     ...+|+|++||+|++.+.+.| ||.|.+.|.|+||+   +|+++|||.-
T Consensus         4 ~~~~i~~~~~~~~-----~~~~p~f~~GDtV~V~~~i~eg~k~R~q~F~GvvI~~r~~G~~~tftvR   65 (117)
T CHL00084          4 LQQLVKEIESEFL-----KKNLPKIRVGDTVKVGVLIQEGNKERVQFYEGTVIAKKNSGLNTTITVR   65 (117)
T ss_pred             HHHHHHHHHHHHh-----hcCCCccCCCCEEEEEEEEecCCeeEeceEEEEEEEEeCCCCCeeEEEE
Confidence            3456666666555     458999999999999999998 57789999999997   9999999963


No 5  
>PF01245 Ribosomal_L19:  Ribosomal protein L19;  InterPro: IPR001857 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L19 is one of the proteins from the large ribosomal subunit [, ]. In Escherichia coli, L19 is known to be located at the 30S-50S ribosomal subunit interface [] and may play a role in the structure and function of the aminoacyl-tRNA binding site. It belongs to a family of ribosomal proteins, including L19 from bacteria and the chloroplasts of red algae. L19 is a protein of 120 to 130 amino-acid residues.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3HUZ_T 3V2D_T 3I8I_R 2XG2_T 2V49_T 2XUX_T 3HUX_T 3I9C_R 3V25_T 3UZ2_R ....
Probab=98.94  E-value=1.9e-09  Score=83.97  Aligned_cols=51  Identities=20%  Similarity=0.249  Sum_probs=44.0

Q ss_pred             HHHhhhcCCCCCCCCCcEEEEEEeeec-CCCCcceeeEEEee---ccCCceeEEe
Q 029551          134 VEASESERPIPDIRTGDVVEIKLFLKI-GVGCPFTKVLLCQG---KMLGSTLQFE  184 (191)
Q Consensus       134 vee~~~~R~iPdiRpGdIVelklEVPE-nkRR~~t~~~ic~~---~glgstf~~~  184 (191)
                      +|.......+|+|+|||+|++.+.++| +|.|.+.|.|+||+   +|++|||++-
T Consensus         7 ~e~~~~~~~~p~f~~GD~v~V~~~i~e~~k~r~q~f~GvvIa~~~~g~~ssftlR   61 (113)
T PF01245_consen    7 VEREQIKKDIPEFRVGDTVRVTYKISEGNKERIQVFEGVVIARRRRGLNSSFTLR   61 (113)
T ss_dssp             HHHTTCSSSSSSSSSSSEEEEEEEEESSSSEEEEEEEEEEEEEEBSSTSSEEEEE
T ss_pred             HHHHHhhcCCCCcCCCCEEEEEEEEecCCCceeEEEEEEEEEEECCCCCeeEEEE
Confidence            444444699999999999999999995 57888999999997   8999999974


No 6  
>COG0335 RplS Ribosomal protein L19 [Translation, ribosomal structure and biogenesis]
Probab=98.32  E-value=1.8e-06  Score=68.72  Aligned_cols=56  Identities=18%  Similarity=0.266  Sum_probs=46.1

Q ss_pred             hHHHHhhHHHHHHhhhcCCCCCCCCCcEEEEEEeeecCCC-CcceeeEEEee---ccCCceeEEe
Q 029551          124 DIMGILNKRAVEASESERPIPDIRTGDVVEIKLFLKIGVG-CPFTKVLLCQG---KMLGSTLQFE  184 (191)
Q Consensus       124 ~IM~ILnkeavee~~~~R~iPdiRpGdIVelklEVPEnkR-R~~t~~~ic~~---~glgstf~~~  184 (191)
                      .|++-|+++.+..-     +|+|+|||.|.+.+-+-|..+ |.+.|.|+||+   +|+++||+.-
T Consensus         4 ~~i~~le~~q~~~~-----iP~f~~GDtvrv~vki~Eg~keR~Q~FeGvVia~r~~G~~~tftvR   63 (115)
T COG0335           4 PIIQQLEQEQIKKD-----IPSFRPGDTVRVHVKIVEGSKERVQAFEGVVIARRGRGISETFTVR   63 (115)
T ss_pred             HHHHHHHHHHHHhh-----CCCCCCCCEEEEEEEEEeCCeEEEeeeeEEEEEECCCCccceEEEE
Confidence            47788888877665     999999999999999887665 46788888875   9999999863


No 7  
>PF09926 DUF2158:  Uncharacterized small protein (DUF2158);  InterPro: IPR019226 This entry represents a family of predominantly prokaryotic proteins with no known function. 
Probab=79.26  E-value=1.2  Score=31.05  Aligned_cols=28  Identities=25%  Similarity=0.292  Sum_probs=17.2

Q ss_pred             CCCCcEEEEE-----EeeecCCC--CcceeeEEEe
Q 029551          146 IRTGDVVEIK-----LFLKIGVG--CPFTKVLLCQ  173 (191)
Q Consensus       146 iRpGdIVelk-----lEVPEnkR--R~~t~~~ic~  173 (191)
                      |++||||+||     |-|-+-..  ........|+
T Consensus         1 f~~GDvV~LKSGGp~MTV~~v~~~~~~~~~~v~C~   35 (53)
T PF09926_consen    1 FKIGDVVQLKSGGPRMTVTEVGPNAGASGGWVECQ   35 (53)
T ss_pred             CCCCCEEEEccCCCCeEEEEccccccCCCCeEEEE
Confidence            6899999997     44432222  2344566776


No 8  
>PF12969 DUF3857:  Domain of Unknown Function with PDB structure (DUF3857);  InterPro: IPR024618 This domain is based on the first domain of the PDB structure 3KD4 (residues 1-228). It is structurally similar to domains in other hydrolases, eg. M1 family aminopeptidase, despite lack of any significant sequence similarity. The domain is N-terminal to a transglutaminase domain, which is found in many proteins known to have transglutaminase activity. The function of this domain is unknown. ; PDB: 3KD4_A.
Probab=74.90  E-value=2.4  Score=32.32  Aligned_cols=22  Identities=32%  Similarity=0.567  Sum_probs=13.2

Q ss_pred             CCCCCCCCCcEEEEEEeeecCC
Q 029551          141 RPIPDIRTGDVVEIKLFLKIGV  162 (191)
Q Consensus       141 R~iPdiRpGdIVelklEVPEnk  162 (191)
                      =.+|++++||||++...+=...
T Consensus        85 ~~~p~v~~GdiIe~~y~~~~~~  106 (177)
T PF12969_consen   85 FAFPDVRVGDIIEYSYTIKSKN  106 (177)
T ss_dssp             EE--S--TT-EEEEEEEEEE-T
T ss_pred             EEcCCCCCCcEEEEEEEEEecC
Confidence            4689999999999999985444


No 9  
>PF05641 Agenet:  Agenet domain;  InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO []. The function of the agenet domain is unknown. This signature matches one of the two Agenet domains in the FMR proteins [].; GO: 0003723 RNA binding; PDB: 2BKD_N 3O8V_A 3KUF_A 3H8Z_A.
Probab=67.30  E-value=17  Score=25.33  Aligned_cols=42  Identities=14%  Similarity=-0.082  Sum_probs=23.2

Q ss_pred             CCCCcEEEEEEeeecCCCCcceeeEEEeeccCCceeEEeeccee
Q 029551          146 IRTGDVVEIKLFLKIGVGCPFTKVLLCQGKMLGSTLQFEFGGLL  189 (191)
Q Consensus       146 iRpGdIVelklEVPEnkRR~~t~~~ic~~~glgstf~~~~~~~~  189 (191)
                      |++||.||++-+...-  |...+-++.+..-..++|..+|-.++
T Consensus         1 F~~G~~VEV~s~e~g~--~gaWf~a~V~~~~~~~~~~V~Y~~~~   42 (68)
T PF05641_consen    1 FKKGDEVEVSSDEDGF--RGAWFPATVLKENGDDKYLVEYDDLP   42 (68)
T ss_dssp             --TT-EEEEEE-SBTT----EEEEEEEEEEETT-EEEEEETT-S
T ss_pred             CCCCCEEEEEEcCCCC--CcEEEEEEEEEeCCCcEEEEEECCcc
Confidence            7899999999876444  55566666654333339998886543


No 10 
>TIGR01352 tonB_Cterm TonB family C-terminal domain. This model represents the C-terminal of TonB and is homologs. TonB is an energy-transducer for TonB-dependent receptors of Gram-negative bacteria. Most members are designated as TonB or TonB-related proteins, but a few represent the paralogous TolA protein. Several bacteria have up to four TonB paralogs. In nearly every case, a proline-rich repetive region is found N-terminal to this domain; these low-complexity regions are highly divergent and cannot readily be aligned. The region is suggested to help span the periplasm.
Probab=65.82  E-value=15  Score=24.21  Aligned_cols=33  Identities=24%  Similarity=0.272  Sum_probs=27.7

Q ss_pred             HHhhHHHHHHhhhcCCCCCCCCCcEEEEEEeee
Q 029551          127 GILNKRAVEASESERPIPDIRTGDVVEIKLFLK  159 (191)
Q Consensus       127 ~ILnkeavee~~~~R~iPdiRpGdIVelklEVP  159 (191)
                      ..||+.+++.+++-+..|....|.-+..++.+|
T Consensus        36 ~~ld~~a~~av~~~~~~p~~~~g~~~~~~~~~~   68 (74)
T TIGR01352        36 EALDRAALEAVRKARFEPPPPNGGPVAQSVTIP   68 (74)
T ss_pred             hhHHHHHHHHHHhCCCCCCCCCCCceeEEEEEe
Confidence            579999999999999999988887666666665


No 11 
>PF10447 EXOSC1:  Exosome component EXOSC1/CSL4;  InterPro: IPR019495  The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions []. The proteins in this entry are components of the exosome 3'->5' exoribonuclease complex. They do not have exonuclease activity, but are required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA and for mRNA decay [, ].; PDB: 2NN6_I.
Probab=64.89  E-value=4.6  Score=30.19  Aligned_cols=32  Identities=31%  Similarity=0.586  Sum_probs=17.2

Q ss_pred             HHHHhhHHHHHHhhhcCC--CCCCCCCcEEEEEE
Q 029551          125 IMGILNKRAVEASESERP--IPDIRTGDVVEIKL  156 (191)
Q Consensus       125 IM~ILnkeavee~~~~R~--iPdiRpGdIVelkl  156 (191)
                      ..|+|.++.|...++.+.  -=-|||||||.=||
T Consensus        46 f~GiIR~~DVR~te~Dkv~~~~~FrpGDIVrA~V   79 (82)
T PF10447_consen   46 FQGIIRKQDVRATEKDKVKMYDCFRPGDIVRARV   79 (82)
T ss_dssp             S-S-EEEEGGGT-SS----GGGT--SSSEEEEEE
T ss_pred             cEEEEEeeeecccccchhhHHhccCCCCEEEEEE
Confidence            456676766666555543  45699999998776


No 12 
>KOG3409 consensus Exosomal 3'-5' exoribonuclease complex, subunit ski4 (Csl4) [Translation, ribosomal structure and biogenesis]
Probab=62.44  E-value=3.5  Score=35.88  Aligned_cols=34  Identities=32%  Similarity=0.553  Sum_probs=27.1

Q ss_pred             HHHHhhHHHHHHhhhcC--CCCCCCCCcEEEEEEee
Q 029551          125 IMGILNKRAVEASESER--PIPDIRTGDVVEIKLFL  158 (191)
Q Consensus       125 IM~ILnkeavee~~~~R--~iPdiRpGdIVelklEV  158 (191)
                      .-++|.||.+.+.++.|  ++--|||||||.-||==
T Consensus       100 FrglirkqdvR~tEkdrv~v~ksFrPgDiVlAkVis  135 (193)
T KOG3409|consen  100 FRGLIRKQDVRATEKDRVKVYKSFRPGDIVLAKVIS  135 (193)
T ss_pred             hcceeehhhccccccchhhhhhccCCCcEEEEEEee
Confidence            34788999998888776  45689999999888643


No 13 
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway.
Probab=58.91  E-value=21  Score=25.76  Aligned_cols=29  Identities=10%  Similarity=-0.252  Sum_probs=20.2

Q ss_pred             CCCCCCCCcEEEEEEeeecCCCCcceeeE
Q 029551          142 PIPDIRTGDVVEIKLFLKIGVGCPFTKVL  170 (191)
Q Consensus       142 ~iPdiRpGdIVelklEVPEnkRR~~t~~~  170 (191)
                      =.=.++|||.+++++++-+..++..++.+
T Consensus        84 f~~pv~pgd~l~i~~~v~~~~~~~~~~~~  112 (131)
T cd01288          84 FRKPVVPGDQLILEVELLKLRRGIGKFKG  112 (131)
T ss_pred             EccccCCCCEEEEEEEEEEeeCCEEEEEE
Confidence            33456789999999999877655433333


No 14 
>PHA03171 UL37 tegument protein; Provisional
Probab=53.08  E-value=8.7  Score=37.32  Aligned_cols=41  Identities=32%  Similarity=0.399  Sum_probs=19.7

Q ss_pred             hhhccccchhhhhhhcCCCCCCccchhhHHHHhhHHHHHHhh
Q 029551           97 VAVEAESEDKVEEEEVKAPRKPRVKLGDIMGILNKRAVEASE  138 (191)
Q Consensus        97 ~~~Ege~~~v~eeeE~~~prkkrkk~g~IM~ILnkeavee~~  138 (191)
                      +++|+|+++.+||.|++.|-....-+--+-| |-+||-++++
T Consensus        96 ~d~~~~~~~~eee~e~~~pevnp~daegl~g-larea~~alk  136 (499)
T PHA03171         96 PDTEAEEEDEEEEIEAPDPEVNPLDAEGLSG-LAREACDALK  136 (499)
T ss_pred             CchhhhhhhhhhhccCCCCCCCCcchhhhhh-hHHHHHHHHH
Confidence            3455555555566666555544443222222 4445544443


No 15 
>cd03440 hot_dog The hotdog fold was initially identified in the E. coli FabA (beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase) structure and subsequently in 4HBT (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A number of other seemingly unrelated proteins also share the hotdog fold.  These proteins have related, but distinct, catalytic activities that include metabolic roles such as thioester hydrolysis in fatty acid metabolism, and degradation of phenylacetic acid and the environmental pollutant 4-chlorobenzoate.  This superfamily also includes the PaaI-like protein FapR, a non-catalytic bacterial homolog involved in transcriptional regulation of fatty acid biosynthesis.
Probab=52.42  E-value=42  Score=19.92  Aligned_cols=46  Identities=17%  Similarity=0.184  Sum_probs=30.0

Q ss_pred             cchhhHHHHhhHHHHHHhhhc--------------CCCCCCCCCcEEEEEEeeecCCCCc
Q 029551          120 VKLGDIMGILNKRAVEASESE--------------RPIPDIRTGDVVEIKLFLKIGVGCP  165 (191)
Q Consensus       120 kk~g~IM~ILnkeavee~~~~--------------R~iPdiRpGdIVelklEVPEnkRR~  165 (191)
                      ...++++..++.-...-...-              +=.-.+++||.|.+++++....++.
T Consensus        18 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~v~~~~~~~~~~~~~   77 (100)
T cd03440          18 VHGGLLLALADEAAGAAAARLGGRGLGAVTLSLDVRFLRPVRPGDTLTVEAEVVRVGRSS   77 (100)
T ss_pred             cchHHHHHHHHHHHHHHHHHhccCCCeEEEEEEEeEEecCCCCCCEEEEEEEEEeccccE
Confidence            335566666666555555431              1223567799999999998877663


No 16 
>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation. The third step of the elongation cycle, the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, is catalyzed by FabA or FabZ.  FabA is bifunctional and catalyzes an additional isomerization reaction of trans-2-acyl-ACP to cis-3-acyl-ACP, an essential reaction to unsaturated fatty acid synthesis.  FabZ is the primary dehydratase that participates in the elongation cycles of saturated as well as unsaturated fatty acid biosynthesis, whereas FabA is more active in the dehydration of beta-hydroxydecanoyl-ACP. The FabA structure is homodimeric with two independent active sites located at the dimer interface.
Probab=51.73  E-value=31  Score=24.68  Aligned_cols=33  Identities=9%  Similarity=-0.197  Sum_probs=22.1

Q ss_pred             CCCCCCCCCcEEEEEEeeecCCCCcceeeEEEe
Q 029551          141 RPIPDIRTGDVVEIKLFLKIGVGCPFTKVLLCQ  173 (191)
Q Consensus       141 R~iPdiRpGdIVelklEVPEnkRR~~t~~~ic~  173 (191)
                      +=.=+++|||.+.+++++-+.+....++.+.+.
T Consensus        84 kf~~~v~pgd~l~i~~~i~~~~~~~~~~~~~~~  116 (131)
T cd00493          84 KFRGPVLPGDTLTLEVELLKVRRGLGKFDGRAY  116 (131)
T ss_pred             EECCCcCCCCEEEEEEEEEEeeCCEEEEEEEEE
Confidence            334467899999999999877664444444333


No 17 
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism]
Probab=49.60  E-value=9.4  Score=37.40  Aligned_cols=34  Identities=21%  Similarity=0.351  Sum_probs=23.4

Q ss_pred             ccchhhHH-HHhhHHHHHHhhhcCCCCCCCCCcEEE
Q 029551          119 RVKLGDIM-GILNKRAVEASESERPIPDIRTGDVVE  153 (191)
Q Consensus       119 rkk~g~IM-~ILnkeavee~~~~R~iPdiRpGdIVe  153 (191)
                      +++.|+.| +++. .-.+.+++.|++||++|||.=.
T Consensus         6 fR~~gk~mVD~Ia-dY~e~ir~r~v~P~v~PGYl~~   40 (511)
T KOG0628|consen    6 FREEGKEMVDYIA-DYLENIRKRRVLPDVKPGYLRD   40 (511)
T ss_pred             HHHHHHHHHHHHH-HHHHhhhccCCCCCCCcchhhh
Confidence            34444433 3333 4568899999999999999643


No 18 
>COG1499 NMD3 NMD protein affecting ribosome stability and mRNA decay [Translation, ribosomal structure and biogenesis]
Probab=47.16  E-value=11  Score=34.82  Aligned_cols=15  Identities=40%  Similarity=0.857  Sum_probs=13.0

Q ss_pred             CCCCCCCCcEEEEEE
Q 029551          142 PIPDIRTGDVVEIKL  156 (191)
Q Consensus       142 ~iPdiRpGdIVelkl  156 (191)
                      .||++||||||.++=
T Consensus       243 rip~~~~gDiV~~~~  257 (355)
T COG1499         243 RIPEFRPGDIVSVRG  257 (355)
T ss_pred             ECCCCCCCCEEEECC
Confidence            599999999998753


No 19 
>PF01472 PUA:  PUA domain;  InterPro: IPR002478  The PUA (PseudoUridine synthase and Archaeosine transglycosylase) domain was named after the proteins in which it was first found []. PUA is a highly conserved RNA-binding motif found in a wide range of archaeal, bacterial and eukaryotic proteins, including enzymes that catalyse tRNA and rRNA post-transcriptional modifications, proteins involved in ribosome biogenesis and translation, as well as in enzymes involved in proline biosynthesis [, ]. The structures of several PUA-RNA complexes reveal a common RNA recognition surface, but also some versatility in the way in which the motif binds to RNA []. PUA motifs are involved in dyskeratosis congenita and cancer, pointing to links between RNA metabolism and human diseases [].; GO: 0003723 RNA binding; PDB: 1ZE2_A 1ZE1_A 1R3E_A 2AB4_A 3R90_D 2J5T_A 2J5V_B 1Q7H_A 2APO_A 2RFK_A ....
Probab=46.85  E-value=32  Score=24.07  Aligned_cols=29  Identities=34%  Similarity=0.341  Sum_probs=18.8

Q ss_pred             hhHHHHHHhhhcCCC---------CCCCCCcEEEEEEe
Q 029551          129 LNKRAVEASESERPI---------PDIRTGDVVEIKLF  157 (191)
Q Consensus       129 Lnkeavee~~~~R~i---------PdiRpGdIVelklE  157 (191)
                      +|+.|++.+...+.+         ++|++||+|.|.-+
T Consensus         5 Vd~~a~~~i~~Ga~L~~~GV~~~~~~f~~gd~V~i~~~   42 (74)
T PF01472_consen    5 VDDGAVEAILNGASLFAPGVVEVDGDFRKGDEVAIVDE   42 (74)
T ss_dssp             E-HHHHHHHHTTSEEEGGGEEEEETT--TTSEEEEEET
T ss_pred             ECccHHHHHHcCCCcchHHhEECCCCcCCCCEEEEEcC
Confidence            566677766665443         67999999998766


No 20 
>PF00122 E1-E2_ATPase:  E1-E2 ATPase p-type cation-transporting ATPase superfamily signature H+-transporting ATPase (proton pump) signature sodium/potassium-transporting ATPase signature;  InterPro: IPR008250 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles []. P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H+, Na+, K+, Mg2+, Ca2+, Ag+ and Ag2+, Zn2+, Co2+, Pb2+, Ni2+, Cd2+, Cu+ and Cu2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2. This entry represents the actuator (A) domain, and some transmembrane helices found in P-type ATPases []. It contains the TGES-loop which is essential for the metal ion binding which results in tight association between the A and P (phosphorylation) domains []. It does not contain the phosphorylation site. It is thought that the large movement of the actuator domain, which is transmitted to the transmembrane helices, is essential to the long distance coupling between formation/decomposition of the acyl phosphate in the cytoplasmic P-domain and the changes in the ion-binding sites buried deep in the membranous region []. This domain has a modulatory effect on the phosphoenzyme processing steps through its nucleotide binding [],[].  P-type (or E1-E2-type) ATPases that form an aspartyl phosphate intermediate in the course of ATP hydrolysis, can be divided into 4 major groups []: (1) Ca2+-transporting ATPases; (2) Na+/K+- and gastric H+/K+-transporting ATPases; (3) plasma membrane H+-transporting ATPases (proton pumps) of plants, fungi and lower eukaryotes; and (4) all bacterial P-type ATPases, except the g2+-ATPase of Salmonella typhimurium, which is more similar to the eukaryotic sequences. However, great variety of sequence analysis methods results in diversity of classification. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0000166 nucleotide binding, 0046872 metal ion binding; PDB: 2XZB_A 1MHS_B 3TLM_A 3A3Y_A 2ZXE_A 3NAL_A 3NAM_A 3NAN_A 2YJ6_B 2IYE_A ....
Probab=46.79  E-value=12  Score=29.91  Aligned_cols=26  Identities=31%  Similarity=0.569  Sum_probs=16.4

Q ss_pred             CCCCCCCCcEEEEEEeeecCCCCcceeeEE
Q 029551          142 PIPDIRTGDVVEIKLFLKIGVGCPFTKVLL  171 (191)
Q Consensus       142 ~iPdiRpGdIVelklEVPEnkRR~~t~~~i  171 (191)
                      +.=+++|||||.|+    .+.+-+.+.+.+
T Consensus        48 ~~~~L~~GDiI~l~----~g~~vPaD~~ll   73 (230)
T PF00122_consen   48 PSSELVPGDIIILK----AGDIVPADGILL   73 (230)
T ss_dssp             EGGGT-TTSEEEEE----TTEBESSEEEEE
T ss_pred             hHhhccceeeeecc----cccccccCccce
Confidence            44589999999984    455555554444


No 21 
>cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. ScCSL4 protein is a subunit of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In S. cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".
Probab=45.41  E-value=16  Score=26.91  Aligned_cols=34  Identities=26%  Similarity=0.459  Sum_probs=19.2

Q ss_pred             HHHhhHHHHHHhhhc--CCCCCCCCCcEEEEEEeee
Q 029551          126 MGILNKRAVEASESE--RPIPDIRTGDVVEIKLFLK  159 (191)
Q Consensus       126 M~ILnkeavee~~~~--R~iPdiRpGdIVelklEVP  159 (191)
                      .++|..+.+...+..  .--=-|||||+|.-|+-=-
T Consensus        39 ~g~l~~~dv~~~~~d~~~~~~~f~~GDiV~AkVis~   74 (92)
T cd05791          39 RGVIRKEDIRATEKDKVEMYKCFRPGDIVRAKVISL   74 (92)
T ss_pred             ccEEEHHHccccccchHHHHhhcCCCCEEEEEEEEc
Confidence            455555554322221  1113489999999988643


No 22 
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional
Probab=45.29  E-value=42  Score=27.50  Aligned_cols=56  Identities=14%  Similarity=0.043  Sum_probs=33.3

Q ss_pred             CCccchhhHHHHhhHHHHHHh---------hhcCCCCCCCCCcEEEEEEeeecCCCCcceeeEEE
Q 029551          117 KPRVKLGDIMGILNKRAVEAS---------ESERPIPDIRTGDVVEIKLFLKIGVGCPFTKVLLC  172 (191)
Q Consensus       117 kkrkk~g~IM~ILnkeavee~---------~~~R~iPdiRpGdIVelklEVPEnkRR~~t~~~ic  172 (191)
                      .+...-+++|...+-=++...         .+.|=.=+++|||.+.++.++-..+++...+.+-+
T Consensus       101 ~~i~hG~f~~aqa~~la~~~~~~~~~~~~i~~irF~kPV~pGD~L~~ea~v~~~~~~~~~v~~~~  165 (185)
T PRK04424        101 TGIARGHHLFAQANSLAVAVIDAELALTGVANIRFKRPVKLGERVVAKAEVVRKKGNKYIVEVKS  165 (185)
T ss_pred             CCeecHHHHHHHHHHHHHHhcCCcEEEEEeeeEEEccCCCCCCEEEEEEEEEEccCCEEEEEEEE
Confidence            344455666766555222211         22233446899999999999997776644444333


No 23 
>cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Rrp4 protein, and Rrp40 and Csl4 proteins, also represented in this group, are subunits of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In Saccharomyces cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".
Probab=45.23  E-value=18  Score=25.05  Aligned_cols=39  Identities=10%  Similarity=0.060  Sum_probs=23.1

Q ss_pred             HHHHhhHHHHHHhhhcCCCCCCCCCcEEEEEEeeecCCC
Q 029551          125 IMGILNKRAVEASESERPIPDIRTGDVVEIKLFLKIGVG  163 (191)
Q Consensus       125 IM~ILnkeavee~~~~R~iPdiRpGdIVelklEVPEnkR  163 (191)
                      ..++|...++..-.....-.-+++||+|..++.--.+.+
T Consensus        30 ~~g~l~~~~~~~~~~~~~~~~~~~GD~i~~~V~~~~~~~   68 (82)
T cd04454          30 GTARLEDSSATEKDKKEIRKSLQPGDLILAKVISLGDDM   68 (82)
T ss_pred             ceEEeechhccCcchHHHHhcCCCCCEEEEEEEEeCCCC
Confidence            334444444432222222334899999999998877653


No 24 
>PF06107 DUF951:  Bacterial protein of unknown function (DUF951);  InterPro: IPR009296 This family consists of several short hypothetical bacterial proteins of unknown function.
Probab=44.47  E-value=14  Score=26.61  Aligned_cols=17  Identities=35%  Similarity=0.522  Sum_probs=13.9

Q ss_pred             CCCCCcEEEEEEeeecC
Q 029551          145 DIRTGDVVEIKLFLKIG  161 (191)
Q Consensus       145 diRpGdIVelklEVPEn  161 (191)
                      ++..||||++|=.=|=.
T Consensus         1 ~~~vgDiV~mKK~HPCG   17 (57)
T PF06107_consen    1 EYEVGDIVEMKKPHPCG   17 (57)
T ss_pred             CccCCCEEEEcCCCCCC
Confidence            57899999999877743


No 25 
>PF08605 Rad9_Rad53_bind:  Fungal Rad9-like Rad53-binding;  InterPro: IPR013914  In Saccharomyces cerevisiae (Baker s yeast), the Rad9 is a key adaptor protein in DNA damage checkpoint pathways. DNA damage induces Rad9 phosphorylation, and Rad53 specifically associates with this region of Rad9, when phosphorylated, via the Rad53 IPR000253 from INTERPRO domain []. There is no clear higher eukaryotic ortholog to Rad9. 
Probab=43.26  E-value=16  Score=29.49  Aligned_cols=13  Identities=38%  Similarity=0.626  Sum_probs=11.8

Q ss_pred             CCCCCCcEEEEEE
Q 029551          144 PDIRTGDVVEIKL  156 (191)
Q Consensus       144 PdiRpGdIVelkl  156 (191)
                      =|||-||+|.++.
T Consensus        58 LDlRIGD~Vkv~~   70 (131)
T PF08605_consen   58 LDLRIGDTVKVDG   70 (131)
T ss_pred             eeeecCCEEEECC
Confidence            4899999999998


No 26 
>PF13550 Phage-tail_3:  Putative phage tail protein
Probab=42.93  E-value=30  Score=25.96  Aligned_cols=14  Identities=21%  Similarity=0.309  Sum_probs=11.8

Q ss_pred             CCCCCCcEEEEEEe
Q 029551          144 PDIRTGDVVEIKLF  157 (191)
Q Consensus       144 PdiRpGdIVelklE  157 (191)
                      ..++|||+|+|.-.
T Consensus       138 ~~l~pGDvi~l~~~  151 (164)
T PF13550_consen  138 LALEPGDVIALSDD  151 (164)
T ss_pred             ccCCCCCEEEEEeC
Confidence            56899999998766


No 27 
>KOG3572 consensus Uncharacterized conserved protein, contains DEP domain [Signal transduction mechanisms]
Probab=41.44  E-value=16  Score=40.04  Aligned_cols=19  Identities=37%  Similarity=0.565  Sum_probs=15.5

Q ss_pred             cCCCCCCCCCcEEEEEEee
Q 029551          140 ERPIPDIRTGDVVEIKLFL  158 (191)
Q Consensus       140 ~R~iPdiRpGdIVelklEV  158 (191)
                      -...|+|+|||||||+-.-
T Consensus       122 ~~~fP~IKpGDIVEI~~~n  140 (1701)
T KOG3572|consen  122 RAKFPEIKPGDIVEILSKN  140 (1701)
T ss_pred             hhhCCCCCCCceEEEeccC
Confidence            3468999999999998643


No 28 
>smart00359 PUA Putative RNA-binding Domain in PseudoUridine synthase and Archaeosine transglycosylase.
Probab=39.05  E-value=78  Score=21.10  Aligned_cols=25  Identities=28%  Similarity=0.133  Sum_probs=17.3

Q ss_pred             CCCCCCcEEEEEEeeecCCCCcceeeEEEe
Q 029551          144 PDIRTGDVVEIKLFLKIGVGCPFTKVLLCQ  173 (191)
Q Consensus       144 PdiRpGdIVelklEVPEnkRR~~t~~~ic~  173 (191)
                      .++++||+|.|.-+     ...+.++|++.
T Consensus        29 ~~~~~g~~V~v~~~-----~g~~vg~G~~~   53 (77)
T smart00359       29 GGIKEGDVVVIVDE-----KGEPLGIGLAN   53 (77)
T ss_pred             CCcCCCCEEEEEcC-----CCCEEEEEEEe
Confidence            57999999998744     34555666654


No 29 
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed
Probab=38.33  E-value=64  Score=24.45  Aligned_cols=20  Identities=15%  Similarity=0.087  Sum_probs=15.6

Q ss_pred             CCCCCcEEEEEEeeecCCCC
Q 029551          145 DIRTGDVVEIKLFLKIGVGC  164 (191)
Q Consensus       145 diRpGdIVelklEVPEnkRR  164 (191)
                      +++|||.|.+++++-+.++.
T Consensus       101 pv~pGd~l~i~~~i~~~~~~  120 (147)
T PRK00006        101 PVVPGDQLILEVELLKQRRG  120 (147)
T ss_pred             ccCCCCEEEEEEEEEEeeCC
Confidence            45699999999999765544


No 30 
>COG0810 TonB Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane]
Probab=36.87  E-value=43  Score=28.29  Aligned_cols=33  Identities=30%  Similarity=0.306  Sum_probs=27.7

Q ss_pred             HHhhHHHHHHhhhcCCCCCCCCCcEEEEEEeee
Q 029551          127 GILNKRAVEASESERPIPDIRTGDVVEIKLFLK  159 (191)
Q Consensus       127 ~ILnkeavee~~~~R~iPdiRpGdIVelklEVP  159 (191)
                      -.||++|++.+++-+..|.+.-|.-+.+++.+|
T Consensus       206 ~~lD~aal~air~~~~~p~~p~~~~~~~~i~~~  238 (244)
T COG0810         206 PALDRAALEAIRKWRFKPPKPGGKKVGIKITIP  238 (244)
T ss_pred             HHHHHHHHHHHHHhccCCCCCCCCccceeEEEE
Confidence            369999999999999999998876657776665


No 31 
>KOG3416 consensus Predicted nucleic acid binding protein [General function prediction only]
Probab=35.60  E-value=21  Score=29.68  Aligned_cols=11  Identities=27%  Similarity=0.679  Sum_probs=9.4

Q ss_pred             CCCCCcEEEEE
Q 029551          145 DIRTGDVVEIK  155 (191)
Q Consensus       145 diRpGdIVelk  155 (191)
                      -|+|||||+|+
T Consensus        61 ~~~PGDIirLt   71 (134)
T KOG3416|consen   61 LIQPGDIIRLT   71 (134)
T ss_pred             ccCCccEEEec
Confidence            48999999985


No 32 
>TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ. This enzyme, FabZ, shows overlapping substrate specificity with FabA with regard to chain length in fatty acid biosynthesis. FabZ works preferentially on shorter chains and is often designated (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase, although its actual specificity is broader. Unlike FabA, FabZ does not function as an isomerase and cannot initiate unsaturated fatty acid biosynthesis. However, only FabZ can act during the elongation of unsaturated fatty acid chains.
Probab=35.49  E-value=83  Score=23.54  Aligned_cols=23  Identities=9%  Similarity=-0.041  Sum_probs=16.9

Q ss_pred             CCCCCCCCCcEEEEEEeeecCCC
Q 029551          141 RPIPDIRTGDVVEIKLFLKIGVG  163 (191)
Q Consensus       141 R~iPdiRpGdIVelklEVPEnkR  163 (191)
                      |=.=.++|||.+++++++-...+
T Consensus        93 kF~~~v~pGd~l~i~~~i~~~~~  115 (140)
T TIGR01750        93 KFRRPVVPGDQLILHAEFLKKRR  115 (140)
T ss_pred             EECCccCCCCEEEEEEEEEEccC
Confidence            33446788999999999875443


No 33 
>COG0250 NusG Transcription antiterminator [Transcription]
Probab=34.82  E-value=33  Score=28.69  Aligned_cols=38  Identities=29%  Similarity=0.382  Sum_probs=26.8

Q ss_pred             hHHHHhhHHHHHHhhhcCCCCCCCCCcEEEE----------EEeeecCCCCc
Q 029551          124 DIMGILNKRAVEASESERPIPDIRTGDVVEI----------KLFLKIGVGCP  165 (191)
Q Consensus       124 ~IM~ILnkeavee~~~~R~iPdiRpGdIVel----------klEVPEnkRR~  165 (191)
                      +||+.|+..    ....++..+|.+||.|+|          +++-....|..
T Consensus       106 ~~l~~~~~~----~~~~~~~~~~e~Gd~VrI~~GpFa~f~g~V~evd~ek~~  153 (178)
T COG0250         106 HILGFLEEE----VAPKKPKVDFEPGDVVRIIDGPFAGFKAKVEEVDEEKGK  153 (178)
T ss_pred             HHHhhcccc----ccCCcccccCCCCCEEEEeccCCCCccEEEEEEcCcCcE
Confidence            366666544    556788899999999998          56666555543


No 34 
>TIGR02266 gmx_TIGR02266 Myxococcus xanthus paralogous domain TIGR02266. This domain is related to Type IV pilus assembly protein PilZ (Pfam model pfam07238). It is found in at least 12 copies in Myxococcus xanthus DK 1622.
Probab=34.60  E-value=1.4e+02  Score=20.74  Aligned_cols=19  Identities=37%  Similarity=0.420  Sum_probs=16.3

Q ss_pred             CCCCCCcEEEEEEeeecCC
Q 029551          144 PDIRTGDVVEIKLFLKIGV  162 (191)
Q Consensus       144 PdiRpGdIVelklEVPEnk  162 (191)
                      .++.+|+.|+|++.+|.+.
T Consensus        35 ~~~~~g~~v~l~l~l~~~~   53 (96)
T TIGR02266        35 KPLAVGTRVELKLTLPGGE   53 (96)
T ss_pred             CCcCCCCEEEEEEEcCCCC
Confidence            3578999999999999874


No 35 
>COG0361 InfA Translation initiation factor 1 (IF-1) [Translation, ribosomal structure and biogenesis]
Probab=34.48  E-value=27  Score=26.19  Aligned_cols=13  Identities=46%  Similarity=0.575  Sum_probs=10.7

Q ss_pred             CCCCCcEEEEEEe
Q 029551          145 DIRTGDVVEIKLF  157 (191)
Q Consensus       145 diRpGdIVelklE  157 (191)
                      -|+|||+|.+.+-
T Consensus        46 ~I~~GD~V~Ve~~   58 (75)
T COG0361          46 RILPGDVVLVELS   58 (75)
T ss_pred             EeCCCCEEEEEec
Confidence            4899999998763


No 36 
>PF04970 LRAT:  Lecithin retinol acyltransferase;  InterPro: IPR007053 This entry represents a conserved sequence region found in proteins from viruses, bacteria and eukaryotes. It contains a well-conserved NCEHF motif, though its function in these proteins is unknown.; PDB: 2KYT_A 4DOT_A 4FA0_A.
Probab=33.56  E-value=57  Score=24.50  Aligned_cols=28  Identities=14%  Similarity=0.140  Sum_probs=17.4

Q ss_pred             CCCCCCCcEEEEEEeeecCCCCcceeeEEEeeccC
Q 029551          143 IPDIRTGDVVEIKLFLKIGVGCPFTKVLLCQGKML  177 (191)
Q Consensus       143 iPdiRpGdIVelklEVPEnkRR~~t~~~ic~~~gl  177 (191)
                      .+.++|||+|++...       ..+=-||.++.|.
T Consensus         4 ~~~~~~GD~I~~~r~-------~y~H~gIYvG~~~   31 (125)
T PF04970_consen    4 KKRLKPGDHIEVPRG-------LYEHWGIYVGDGE   31 (125)
T ss_dssp             --S--TT-EEEEEET-------TEEEEEEEEETTE
T ss_pred             ccCCCCCCEEEEecC-------CccEEEEEecCCe
Confidence            356899999998755       6777788887553


No 37 
>PF02765 POT1:  Telomeric single stranded DNA binding POT1/CDC13;  InterPro: IPR011564  This entry represents a domain that binds single stranded telomeric DNA and adopts an OB fold []. It includes the proteins POT1 and CDC13 which have been shown to regulate telomere length, replication and capping [, , ]. ; GO: 0003677 DNA binding, 0000723 telomere maintenance, 0000784 nuclear chromosome, telomeric region; PDB: 1S40_A 1KXL_A 1PH7_A 1PH9_A 1PH2_A 1OTC_A 1PHJ_A 1JB7_A 1PA6_A 1PH1_A ....
Probab=32.85  E-value=40  Score=26.39  Aligned_cols=21  Identities=19%  Similarity=0.605  Sum_probs=15.9

Q ss_pred             CCCCC-CcEEEEE-EeeecCCCC
Q 029551          144 PDIRT-GDVVEIK-LFLKIGVGC  164 (191)
Q Consensus       144 PdiRp-GdIVelk-lEVPEnkRR  164 (191)
                      |.++. ||||.|+ +.|-.=+++
T Consensus        71 P~v~~~GDii~l~r~kv~~~~~~   93 (146)
T PF02765_consen   71 PNVKSVGDIIRLRRVKVQSYNGK   93 (146)
T ss_dssp             CTTCSTTHEEEEEEEEEEEETTE
T ss_pred             CCCCCCCCEEEEEEEEEEEECCE
Confidence            99999 9999887 666544444


No 38 
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional
Probab=32.78  E-value=59  Score=26.04  Aligned_cols=20  Identities=15%  Similarity=0.119  Sum_probs=15.8

Q ss_pred             CCCCCCCCcEEEEEEeeecC
Q 029551          142 PIPDIRTGDVVEIKLFLKIG  161 (191)
Q Consensus       142 ~iPdiRpGdIVelklEVPEn  161 (191)
                      =+=++++||.|..+++|-+-
T Consensus        93 f~~PV~~GDtL~~~~eV~~~  112 (159)
T PRK13692         93 FEKPIVAGDKLYCDVYVDSV  112 (159)
T ss_pred             EeCCccCCCEEEEEEEEEEE
Confidence            33468999999999999654


No 39 
>PF05697 Trigger_N:  Bacterial trigger factor protein (TF);  InterPro: IPR008881 In the Escherichia coli cytosol, a fraction of the newly synthesised proteins requires the activity of molecular chaperones for folding to the native state. The major chaperones implicated in this folding process are the ribosome-associated Trigger Factor (TF), and the DnaK and GroEL chaperones with their respective co-chaperones. Trigger Factor is an ATP-independent chaperone and displays chaperone and peptidyl-prolyl-cis-trans-isomerase (PPIase) activities in vitro. It is composed of at least three domains, an N-terminal domain which mediates association with the large ribosomal subunit, a central substrate binding and PPIase domain with homology to FKBP proteins, and a C-terminal domain of unknown function. The positioning of TF at the peptide exit channel, together with its ability to interact with nascent chains as short as 57 residues renders TF a prime candidate for being the first chaperone that binds to the nascent polypeptide chains []. This group of sequences contain the ribosomal subunit association domain.; GO: 0006457 protein folding, 0015031 protein transport; PDB: 2D3O_1 1W26_A 1P9Y_A 1OMS_C 1T11_A 3GU0_A 2NSB_A 2NSC_A 3GTY_X.
Probab=31.36  E-value=38  Score=26.08  Aligned_cols=22  Identities=23%  Similarity=0.424  Sum_probs=16.6

Q ss_pred             hhHHHHHHhhhcCCCCCCCCCc
Q 029551          129 LNKRAVEASESERPIPDIRTGD  150 (191)
Q Consensus       129 Lnkeavee~~~~R~iPdiRpGd  150 (191)
                      .-.+++.++.+.=.||.||+|=
T Consensus        27 ~~~~~l~~~~k~~~ipGFRkGK   48 (145)
T PF05697_consen   27 AYEKALKELAKKVKIPGFRKGK   48 (145)
T ss_dssp             HHHHHHHHHHTTTTBTTS-TTS
T ss_pred             HHHHHHHHHHhhCCCCCCCCCC
Confidence            3456778888888999999994


No 40 
>PRK09521 exosome complex RNA-binding protein Csl4; Provisional
Probab=30.90  E-value=20  Score=29.28  Aligned_cols=36  Identities=17%  Similarity=0.217  Sum_probs=23.1

Q ss_pred             HHHHhhHHHHHHhhhcCCCCCCCCCcEEEEEEeeec
Q 029551          125 IMGILNKRAVEASESERPIPDIRTGDVVEIKLFLKI  160 (191)
Q Consensus       125 IM~ILnkeavee~~~~R~iPdiRpGdIVelklEVPE  160 (191)
                      +.++|....+..-........|++||+|..|+.--+
T Consensus        98 ~~G~l~~s~i~~~~~~~~~~~~~~GD~V~akV~~i~  133 (189)
T PRK09521         98 KLAYIHISQVSDGYVESLTDAFKIGDIVRAKVISYT  133 (189)
T ss_pred             ceeeEEhhHcChhhhhhHHhccCCCCEEEEEEEecC
Confidence            445555555433222334556999999999987666


No 41 
>cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 11 (hs11) and S. cerevisiae S1 repeat 8 (sc8). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=30.73  E-value=59  Score=21.89  Aligned_cols=17  Identities=12%  Similarity=0.579  Sum_probs=12.8

Q ss_pred             CCCCCCCCCcEEEEEEe
Q 029551          141 RPIPDIRTGDVVEIKLF  157 (191)
Q Consensus       141 R~iPdiRpGdIVelklE  157 (191)
                      .+.--+++||+|+.|+-
T Consensus        42 ~~~~~~~~Gd~i~~kVl   58 (70)
T cd05702          42 NPLSKFKIGQKIKARVI   58 (70)
T ss_pred             ChhHhCCCCCEEEEEEE
Confidence            33344899999999963


No 42 
>cd04491 SoSSB_OBF SoSSB_OBF: A subfamily of OB folds similar to the OB fold of the crenarchaeote Sulfolobus solfataricus single-stranded (ss) DNA-binding protein (SSoSSB). SSoSSB has a single OB fold, and it physically and functionally interacts with RNA polymerase. In vitro, SSoSSB can substitute for the basal transcription factor TBP, stimulating transcription from promoters under conditions in which TBP is limiting, and supporting transcription when TBP is absent. SSoSSB selectively melts the duplex DNA of promoter sequences. It also relieves transcriptional repression by the chromatin Alba. In addition, SSoSSB activates reverse gyrase activity, which involves DNA binding, DNA cleavage, strand passage and ligation. SSoSSB stimulates all these steps in the presence of the chromatin protein, Sul7d. SSoSSB antagonizes the inhibitory effect of Sul7d on reverse gyrase supercoiling activity. It also physically and functionally interacts with Mini-chromosome Maintenance (MCM), stimulating 
Probab=29.65  E-value=79  Score=21.92  Aligned_cols=23  Identities=30%  Similarity=0.444  Sum_probs=18.6

Q ss_pred             CCCCCCCcEEEEE-EeeecCCCCc
Q 029551          143 IPDIRTGDVVEIK-LFLKIGVGCP  165 (191)
Q Consensus       143 iPdiRpGdIVelk-lEVPEnkRR~  165 (191)
                      .+.+.+||+|.++ ..+=+.+.+.
T Consensus        46 ~~~~~~G~vv~i~~~~v~~~~g~~   69 (82)
T cd04491          46 ADDLEPGDVVRIENAYVREFNGRL   69 (82)
T ss_pred             cccCCCCCEEEEEeEEEEecCCcE
Confidence            6779999999999 8887766554


No 43 
>PF02563 Poly_export:  Polysaccharide biosynthesis/export protein;  InterPro: IPR003715 The extracellular polysaccharide colanic acid (CA) is produced by species of the family Enterobacteriaceae. In Escherichia coli (strain K12) the CA cluster comprises 19 genes. The wzx gene encodes a protein with multiple transmembrane segments that may function in export of the CA repeat unit from the cytoplasm into the periplasm in a process analogous to O-unit export. The CA gene clusters may be involved in the export of polysaccharide from the cell [].; GO: 0015159 polysaccharide transmembrane transporter activity, 0015774 polysaccharide transport, 0016020 membrane; PDB: 2W8I_E 2W8H_E 2J58_D.
Probab=29.61  E-value=38  Score=24.08  Aligned_cols=13  Identities=38%  Similarity=0.805  Sum_probs=7.9

Q ss_pred             CCCCCcEEEEEEe
Q 029551          145 DIRTGDVVEIKLF  157 (191)
Q Consensus       145 diRpGdIVelklE  157 (191)
                      -|.|||+|+|++-
T Consensus        12 ~l~pGD~l~i~v~   24 (82)
T PF02563_consen   12 RLGPGDVLRISVF   24 (82)
T ss_dssp             ---TT-EEEEEET
T ss_pred             EECCCCEEEEEEe
Confidence            4789999999883


No 44 
>PRK11507 ribosome-associated protein; Provisional
Probab=29.58  E-value=34  Score=25.34  Aligned_cols=9  Identities=33%  Similarity=0.545  Sum_probs=7.9

Q ss_pred             CCCCcEEEE
Q 029551          146 IRTGDVVEI  154 (191)
Q Consensus       146 iRpGdIVel  154 (191)
                      +||||+|++
T Consensus        53 l~~GD~V~~   61 (70)
T PRK11507         53 IVAGQTVSF   61 (70)
T ss_pred             CCCCCEEEE
Confidence            789999987


No 45 
>cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain. Both domains are members of the Oligonucleotide/oligosaccharide Binding (OB) fold.
Probab=29.39  E-value=43  Score=20.51  Aligned_cols=15  Identities=33%  Similarity=0.507  Sum_probs=12.4

Q ss_pred             CCCCCcEEEEEEeee
Q 029551          145 DIRTGDVVEIKLFLK  159 (191)
Q Consensus       145 diRpGdIVelklEVP  159 (191)
                      .+++||+|++++-=-
T Consensus        41 ~~~~G~~v~~~v~~~   55 (65)
T cd00164          41 VFKVGDEVEVKVLEV   55 (65)
T ss_pred             EeCCCCEEEEEEEEE
Confidence            489999999998644


No 46 
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional
Probab=28.96  E-value=51  Score=28.14  Aligned_cols=37  Identities=14%  Similarity=-0.050  Sum_probs=23.8

Q ss_pred             HHHHhhHHHHHHhh----hcCCCCCCCCCcEEEEEEeeecC
Q 029551          125 IMGILNKRAVEASE----SERPIPDIRTGDVVEIKLFLKIG  161 (191)
Q Consensus       125 IM~ILnkeavee~~----~~R~iPdiRpGdIVelklEVPEn  161 (191)
                      .-++|....+...+    ..+.-+-|++||+|..||.--..
T Consensus        87 ~~g~L~~s~i~~~~~~~d~~~~~~~~~~GDlV~akV~~i~~  127 (235)
T PRK04163         87 YKAYLPVSEVLGRPVNVEGTDLRKYLDIGDYIIAKVKDVDR  127 (235)
T ss_pred             ceeEEEHHHcCCCccccchhhhHhhCCCCCEEEEEEEEECC
Confidence            44566666654432    23445569999999999975543


No 47 
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms]
Probab=28.89  E-value=74  Score=29.44  Aligned_cols=59  Identities=19%  Similarity=0.190  Sum_probs=42.5

Q ss_pred             hhHHHHhhHHHHH--HhhhcCCCCCCCCCcEEEEEEeeecCCCCcceeeEEEeeccCCceeE
Q 029551          123 GDIMGILNKRAVE--ASESERPIPDIRTGDVVEIKLFLKIGVGCPFTKVLLCQGKMLGSTLQ  182 (191)
Q Consensus       123 g~IM~ILnkeave--e~~~~R~iPdiRpGdIVelklEVPEnkRR~~t~~~ic~~~glgstf~  182 (191)
                      .-+|.+.+.+.+-  .-=+|-.+..+|+|+-++|++.--... -.+.+++--|+-|-|++|.
T Consensus       234 ~~l~alVp~~~~yV~AnFkETqL~~~r~Gq~a~I~~da~~~~-~~~~G~v~~i~~~tg~~fs  294 (352)
T COG1566         234 TPLMALVPLDSFYVVANFKETQLARVRPGQPAEITLDAYPGN-GVVEGIVEGIAPATGSAFS  294 (352)
T ss_pred             CceEEEecccceEEEeeeeeeecCcccCCCeEEEEEEcCCCc-eEEEEEEEEecCCcccccc
Confidence            3678887766654  344677899999999999999875443 4556666666677788764


No 48 
>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT).  Brain acyl-CoA hydrolase (BACH).  These enzymes deacylate long-chain fatty acids by hydrolyzing acyl-CoA thioesters to free fatty acids and CoA-SH. Eukaryotic members of this family are expressed in brain, testis, and brown adipose tissues. The archeal and eukaryotic members of this family have two tandem copies of the conserved hot dog fold, while most bacterial members have only one copy.
Probab=28.75  E-value=1.1e+02  Score=21.42  Aligned_cols=25  Identities=24%  Similarity=0.238  Sum_probs=19.5

Q ss_pred             CCCCCcEEEEEEeeecCCCCcceee
Q 029551          145 DIRTGDVVEIKLFLKIGVGCPFTKV  169 (191)
Q Consensus       145 diRpGdIVelklEVPEnkRR~~t~~  169 (191)
                      ++++||.|+++..+-.-.|+..+..
T Consensus        63 p~~~gd~l~i~~~v~~~g~~~~~~~   87 (123)
T cd03442          63 PVRVGDVVELSARVVYTGRTSMEVG   87 (123)
T ss_pred             ccccCcEEEEEEEEEEecCCeEEEE
Confidence            4679999999999988777654443


No 49 
>TIGR00451 unchar_dom_2 uncharacterized domain 2. This uncharacterized domain is found a number of enzymes and uncharacterized proteins, often at the C-terminus. It is found in some but not all members of a family of related tRNA-guanine transglycosylases (tgt), which exchange a guanine base for some modified base without breaking the phosphodiester backbone of the tRNA. It is also found in rRNA pseudouridine synthase, another enzyme of RNA base modification not otherwise homologous to tgt. It is found, again at the C-terminus, in two putative glutamate 5-kinases. It is also found in a family of small, uncharacterized archaeal proteins consisting mostly of this domain.
Probab=28.70  E-value=64  Score=23.93  Aligned_cols=29  Identities=24%  Similarity=0.274  Sum_probs=19.3

Q ss_pred             hhHHHHHHhhhcCCC---------CCCCCCcEEEEEEe
Q 029551          129 LNKRAVEASESERPI---------PDIRTGDVVEIKLF  157 (191)
Q Consensus       129 Lnkeavee~~~~R~i---------PdiRpGdIVelklE  157 (191)
                      +|+.+++.+..-..+         .+|++||+|.|..+
T Consensus        35 vd~~a~~~l~~Ga~L~~pGV~~~~~~~~~gd~V~I~~~   72 (107)
T TIGR00451        35 VDNGAVKFLKNGADVMRPGIVDADEDIKEGDDVVVVDE   72 (107)
T ss_pred             EChhHHHHHHCCccccCCeeEeCCCCcCCCCEEEEEEC
Confidence            455566655443332         58999999999864


No 50 
>smart00357 CSP Cold shock protein domain. RNA-binding domain that functions as a RNA-chaperone in bacteria and is involved in regulating translation in eukaryotes. Contains sub-family of RNA-binding domains in the Rho transcription termination factor.
Probab=28.45  E-value=89  Score=19.67  Aligned_cols=18  Identities=33%  Similarity=0.510  Sum_probs=15.2

Q ss_pred             CCCCCCCcEEEEEEeeec
Q 029551          143 IPDIRTGDVVEIKLFLKI  160 (191)
Q Consensus       143 iPdiRpGdIVelklEVPE  160 (191)
                      ...+++||.|..++.-++
T Consensus        34 ~~~~~~Gd~V~~~i~~~~   51 (64)
T smart00357       34 LKSLREGDEVEFKVVSPR   51 (64)
T ss_pred             CCcCCCCCEEEEEEEEcc
Confidence            567899999999998764


No 51 
>COG2030 MaoC Acyl dehydratase [Lipid metabolism]
Probab=28.10  E-value=90  Score=24.72  Aligned_cols=29  Identities=10%  Similarity=0.059  Sum_probs=23.1

Q ss_pred             hhcCCCCCCCCCcEEEEEEeeecCCCCcc
Q 029551          138 ESERPIPDIRTGDVVEIKLFLKIGVGCPF  166 (191)
Q Consensus       138 ~~~R~iPdiRpGdIVelklEVPEnkRR~~  166 (191)
                      .+.|=+=++++||.|..+++|-+.+.+.+
T Consensus        99 ~~vRF~~PV~~Gdtl~~~~~v~~~~~~~~  127 (159)
T COG2030          99 DEVRFVKPVFPGDTLRARVEVLDKRPSKS  127 (159)
T ss_pred             cceEecCCCCCCCEEEEEEEEEEeeecCC
Confidence            45566778999999999999987765554


No 52 
>PF07238 PilZ:  PilZ domain;  InterPro: IPR009875 The ubiquitous bacterial second messenger cyclic-di-GMP (c-di-GMP) is associated with the regulation of biofilm formation, the control of exopolysaccharide synthesis, flagellar- and pili-based motility, gene expression, interactions of bacteria with eukaryotic hosts and multicellular behaviour in diverse bacteria. With the exception of bacterial cellulose synthases, the identities of c-di-GMP receptors and end targets of the proteins having one or more PilZ domains are mostly uncharacterised. However it was suggested that the PilZ domains present in the BcsA subunits of bacterial cellulose synthases function in c-di-GMP binding []. More recently YcgR (see IPR023787 from INTERPRO) was found to bind c-di-GMP tightly and specifically; also isolated PilZ domains from YcgR and BcsA bound c-di-GMP indicating that the PilZ domain was sufficient for binding of c-di-GMP and significantly that site-directed mutagenesis performed on YcgR implicated the most conserved residues in the PilZ domain directly in c-di-GMP binding []. It was suggested that c-di-GMP binding to PilZ brings about conformational changes in the protein that stabilise the bound ligand and probability initiates the downstream signal transduction cascade. In the case of YcgR, c-di-GMP binding regulates flagellum-based motility in a c-di-GMP-dependent manner (see IPR023787 from INTERPRO) []. The association of the PilZ domain with a variety of other domains, including likely components of bacterial multidrug secretion system, could provide clues to multiple functions of the c-di-GMP in bacterial pathogenesis and cell development. Binding and mutagenesis studies of several PilZ domain proteins have confirmed this observation and demonstrated that c-di-GMP binding depends on residues in RxxxR and D/NxSxxG sequence motifs. The crystal structure, at 1.7 A, of a PilZ domain::c-di-GMP complex from Vibrio cholerae shows c-di-GMP contacting seven of nine strongly conserved residues. Binding of c-di-GMP causes a conformational switch whereby the C- and N-terminal domains are brought into close opposition forming a new allosteric interaction surface that spans these domains and the c-di-GMP at their interface []. ; GO: 0035438 cyclic-di-GMP binding; PDB: 2RDE_B 1YLN_A 3KYG_A 3DSG_B 2GJG_A 3KYF_A 1YWU_A 2L74_A 2L1T_A 3CNR_A ....
Probab=27.88  E-value=1.4e+02  Score=19.86  Aligned_cols=20  Identities=25%  Similarity=0.197  Sum_probs=14.8

Q ss_pred             CCCCCcEEEEEEeeecCCCC
Q 029551          145 DIRTGDVVEIKLFLKIGVGC  164 (191)
Q Consensus       145 diRpGdIVelklEVPEnkRR  164 (191)
                      ++.+|+.|+|++..+....-
T Consensus        44 ~~~~~~~v~l~~~~~~~~~~   63 (102)
T PF07238_consen   44 PLEPGDRVRLSFSLPGGGFP   63 (102)
T ss_dssp             G--TTSEEEEEEECTTTSCE
T ss_pred             CCCCCCEEEEEEEeCCCCee
Confidence            68899999999988876654


No 53 
>cd04497 hPOT1_OB1_like hPOT1_OB1_like: A subfamily of OB folds similar to the first OB fold (OB1) of human protection of telomeres 1 protein (hPOT1), the single OB fold of the N-terminal domain of Schizosaccharomyces pombe POT1 (SpPOT1), and the first OB fold of the N-terminal domain of the alpha subunit (OB1Nalpha) of Oxytricha nova telomere end binding protein (OnTEBP). POT1 proteins recognize single-stranded (ss) 3-prime ends of the telomere. A 3-prime ss overhang is conserved in ciliated protozoa, yeast, and mammals. SpPOT1 is essential for telomere maintenance. It binds specifically to the ss G-rich telomeric sequence (GGTTAC) of S. pombe. hPOT1 binds specifically to ss telomeric DNA repeats ending with the sequence GGTTAG. Deletion of the S. pombe pot1+ gene results in a rapid loss of telomere sequences, chromosome mis-segregation and chromosome circularization. hPOT1 is implicated in telomere length regulation. The hPOT1 monomer consists of two closely connected OB folds (OB1-OB
Probab=27.73  E-value=48  Score=25.83  Aligned_cols=15  Identities=20%  Similarity=0.742  Sum_probs=12.4

Q ss_pred             CCCCCCCCCcEEEEE
Q 029551          141 RPIPDIRTGDVVEIK  155 (191)
Q Consensus       141 R~iPdiRpGdIVelk  155 (191)
                      ..+|.+..||||.||
T Consensus        64 ~~LP~v~~GDVIll~   78 (138)
T cd04497          64 ESLPIVKVGDIILLR   78 (138)
T ss_pred             hhCCCCCCCCEEEEE
Confidence            348888999999875


No 54 
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only]
Probab=27.61  E-value=14  Score=34.31  Aligned_cols=45  Identities=18%  Similarity=0.159  Sum_probs=39.2

Q ss_pred             CccchhhHHHHhhHHHHHHhhhcCCCCCCCCCcEEEEEEeeecCC
Q 029551          118 PRVKLGDIMGILNKRAVEASESERPIPDIRTGDVVEIKLFLKIGV  162 (191)
Q Consensus       118 krkk~g~IM~ILnkeavee~~~~R~iPdiRpGdIVelklEVPEnk  162 (191)
                      ||..++-|.--+--+.+|++-++.-.||+..-..+-+|.|+||.+
T Consensus       140 kRRh~RTiFT~~Qle~LEkaFkeaHYPDv~Are~la~ktelpEDR  184 (332)
T KOG0494|consen  140 KRRHFRTIFTSYQLEELEKAFKEAHYPDVYAREMLADKTELPEDR  184 (332)
T ss_pred             ccccccchhhHHHHHHHHHHHhhccCccHHHHHHHhhhccCchhh
Confidence            444478888888889999999999999999999999999999853


No 55 
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes. FkbR2  has sequence similarity to (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.  The function of FkbR2 is unknown.
Probab=26.51  E-value=1.1e+02  Score=22.59  Aligned_cols=21  Identities=10%  Similarity=-0.070  Sum_probs=16.5

Q ss_pred             CCCCCCCcEEEEEEeeecCCC
Q 029551          143 IPDIRTGDVVEIKLFLKIGVG  163 (191)
Q Consensus       143 iPdiRpGdIVelklEVPEnkR  163 (191)
                      .=+++|||.|.++++|=+.++
T Consensus        89 ~~pv~~GDtl~~~~~v~~~~~  109 (146)
T cd03451          89 PAPVFHGDTLYAESEVLSKRE  109 (146)
T ss_pred             cCCCCCCCEEEEEEEEEEEec
Confidence            345789999999999976543


No 56 
>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu. The C-terminal part of mtIF2 contains the entire fMet-tRNAfmet binding site of IF-2 and is resistant to proteolysis. This C-terminal portion consists of two domains, IF2 C1 and IF2 C2.  IF2 C2 been shown to contain all molecular determinants necessary and sufficient for the recognition and binding of fMet-tRNAfMet. Like IF2 from certain prokaryotes such as Thermus thermophilus, mtIF2lacks domain II which is thought  to be involved in binding of E.coli IF-2 to 30S subunits.
Probab=25.57  E-value=42  Score=24.01  Aligned_cols=11  Identities=45%  Similarity=0.987  Sum_probs=9.1

Q ss_pred             CCCCCCCcEEE
Q 029551          143 IPDIRTGDVVE  153 (191)
Q Consensus       143 iPdiRpGdIVe  153 (191)
                      +.||++||++|
T Consensus        73 ~~d~~~Gdvi~   83 (84)
T cd03692          73 FNDIKVGDIIE   83 (84)
T ss_pred             cccCCCCCEEE
Confidence            44999999987


No 57 
>PF03544 TonB_C:  Gram-negative bacterial TonB protein C-terminal;  InterPro: IPR006260 The sequences in this set all contain a conserved C-terminal domain which is characteristic of TonB and is homologs. TonB is an energy-transducer for TonB-dependent receptors of Gram-negative bacteria []. Most members are designated as TonB or TonB-related proteins, but a few represent the paralogous TolA protein. Several bacteria have up to four TonB paralogs. In nearly every case, a proline-rich repetitive region is found N-terminal to this domain; these low-complexity regions are highly divergent and cannot readily be aligned. The region is suggested to span the periplasm.  Iron is essential for growth in both bacteria and mammals. Controlling the amount of free iron in solution is often used as a tactic by hosts to limit invasion of pathogenic microbes; binding iron tightly within protein molecules can accomplish this. Some bacteria express surface receptors to capture eukaryotic iron-binding compounds, while others have evolved siderophores to scavenge iron from iron-binding host proteins [].  The absence of free iron molecules in the surrounding environment triggers transcription of gene clusters that encode both siderophore-synthesis ezymes, and receptors that recognise iron-bound siderophores []. An example of the latter is Escherichia coli fepA, which resides in the outer envelope and captures iron-bound enterobactin [].  To complete transport of bound iron across the inner membrane, a second receptor complex is needed. The major component of this is tonB, a 27kDa protein that facilitates energy transfer from the proton motive force to outer receptors. B-12 and colicin receptors also make use of the tonB system to drive active transport at the outer membrane.; GO: 0008565 protein transporter activity, 0015031 protein transport, 0016020 membrane, 0030288 outer membrane-bounded periplasmic space; PDB: 1U07_B 1IHR_A 2GRX_C 2GSK_B 1QXX_A 1XX3_A 2K9K_A.
Probab=25.32  E-value=53  Score=21.85  Aligned_cols=32  Identities=25%  Similarity=0.341  Sum_probs=23.8

Q ss_pred             HhhHHHHHHhhhcCCCCCCCCCcEEEEEEeee
Q 029551          128 ILNKRAVEASESERPIPDIRTGDVVEIKLFLK  159 (191)
Q Consensus       128 ILnkeavee~~~~R~iPdiRpGdIVelklEVP  159 (191)
                      +||+++++.+++.+-.|...-|.-+.+++.+|
T Consensus        43 ~l~~~a~~~v~~~~~~p~~~~g~~~~~~~~~~   74 (79)
T PF03544_consen   43 ILDEAALRAVKKWRFKPAPKNGKPVKVTYTVP   74 (79)
T ss_dssp             CSHHHHHHHHCC-EE-TT--CCEECEEEEEEE
T ss_pred             HHHHHHHHHHHhCCCCCCCcCCEEEEEEEEEE
Confidence            79999999999988888777788888877666


No 58 
>TIGR02219 phage_NlpC_fam putative phage cell wall peptidase, NlpC/P60 family. Members of this family show sequence similarity to members of the NlpC/P60 family described by Pfam model pfam00877 and by Anantharaman and Aravind (PubMed:12620121). The NlpC/P60 family includes a number of characterized bacterial cell wall hydrolases. Members of this related family are all found in prophage regions of bacterial genomes.
Probab=25.31  E-value=1.5e+02  Score=22.88  Aligned_cols=27  Identities=15%  Similarity=0.283  Sum_probs=19.2

Q ss_pred             CCCCCCcEEEEEEeeecCCCCcceeeEEEee
Q 029551          144 PDIRTGDVVEIKLFLKIGVGCPFTKVLLCQG  174 (191)
Q Consensus       144 PdiRpGdIVelklEVPEnkRR~~t~~~ic~~  174 (191)
                      -+++|||+|-.+.    +..+...=+||.++
T Consensus        75 ~~~qpGDlvff~~----~~~~~~~HvGIy~G  101 (134)
T TIGR02219        75 DAAQPGDVLVFRW----RPGAAAKHAAIAAS  101 (134)
T ss_pred             hcCCCCCEEEEee----CCCCCCcEEEEEeC
Confidence            3799999999874    22333457888875


No 59 
>TIGR03684 arCOG00985 arCOG04150 universal archaeal PUA-domain protein. This universal archaeal protein contains a domain possibly associated with RNA binding (pfam01472, TIGR00451).
Probab=25.25  E-value=1.2e+02  Score=23.89  Aligned_cols=14  Identities=36%  Similarity=0.527  Sum_probs=12.5

Q ss_pred             CCCCCCcEEEEEEe
Q 029551          144 PDIRTGDVVEIKLF  157 (191)
Q Consensus       144 PdiRpGdIVelklE  157 (191)
                      ++|++||+|.|..+
T Consensus        98 ~~~~~Gd~V~I~~~  111 (150)
T TIGR03684        98 PSIKEGDIVFVVDE  111 (150)
T ss_pred             CCCCCCCEEEEEEC
Confidence            68999999999875


No 60 
>PF12945 YcgR_2:  Flagellar protein YcgR; PDB: 2RDE_B 1YLN_A 3KYG_A.
Probab=25.14  E-value=68  Score=21.90  Aligned_cols=25  Identities=16%  Similarity=0.208  Sum_probs=13.4

Q ss_pred             CCCCcEEEEEEeeecCCC--CcceeeE
Q 029551          146 IRTGDVVEIKLFLKIGVG--CPFTKVL  170 (191)
Q Consensus       146 iRpGdIVelklEVPEnkR--R~~t~~~  170 (191)
                      |++|+.|+|.+.=|.+.+  -.+.+++
T Consensus         1 L~iG~~i~i~i~~~~~~~~~y~S~v~g   27 (87)
T PF12945_consen    1 LKIGQKIEIEITNPTGEKGRYKSRVIG   27 (87)
T ss_dssp             --TT-EEEEEEE-TTS-EEEEEEEEEE
T ss_pred             CCCCCEEEEEEECCCCceEEEEEEEEE
Confidence            589999999887776433  3444444


No 61 
>PF01191 RNA_pol_Rpb5_C:  RNA polymerase Rpb5, C-terminal domain;  InterPro: IPR000783  Prokaryotes contain a single DNA-dependent RNA polymerase (RNAP; 2.7.7.6 from EC) that is responsible for the transcription of all genes, while eukaryotes have three classes of RNAPs (I-III) that transcribe different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. Certain subunits of RNAPs, including RPB5 (POLR2E in mammals), are common to all three eukaryotic polymerases. RPB5 plays a role in the transcription activation process. Eukaryotic RPB5 has a bipartite structure consisting of a unique N-terminal region (IPR005571 from INTERPRO), plus a C-terminal region that is structurally homologous to the prokaryotic RPB5 homologue, subunit H (gene rpoH) [, , , ]. This entry represents prokaryotic subunit H and the C-terminal domain of eukaryotic RPB5, which share a two-layer alpha/beta fold, with a core structure of beta/alpha/beta/alpha/beta(2). ; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 1EIK_A 2Y0S_Z 1DZF_A 3GTG_E 2VUM_E 3GTP_E 3GTO_E 3S17_E 3S1R_E 1I3Q_E ....
Probab=25.14  E-value=44  Score=24.80  Aligned_cols=11  Identities=45%  Similarity=0.706  Sum_probs=8.0

Q ss_pred             CCCCCcEEEEE
Q 029551          145 DIRTGDVVEIK  155 (191)
Q Consensus       145 diRpGdIVelk  155 (191)
                      ++++||||+|.
T Consensus        48 g~k~GdVvkI~   58 (74)
T PF01191_consen   48 GAKPGDVVKII   58 (74)
T ss_dssp             T--TTSEEEEE
T ss_pred             CCCCCCEEEEE
Confidence            78999999985


No 62 
>PF13275 S4_2:  S4 domain; PDB: 1P9K_A.
Probab=24.96  E-value=40  Score=24.40  Aligned_cols=10  Identities=70%  Similarity=1.125  Sum_probs=6.2

Q ss_pred             CCCCCcEEEE
Q 029551          145 DIRTGDVVEI  154 (191)
Q Consensus       145 diRpGdIVel  154 (191)
                      -+|+||+|++
T Consensus        48 Kl~~GD~V~~   57 (65)
T PF13275_consen   48 KLRPGDVVEI   57 (65)
T ss_dssp             ---SSEEEEE
T ss_pred             cCCCCCEEEE
Confidence            3789999987


No 63 
>PF07703 A2M_N_2:  Alpha-2-macroglobulin family N-terminal region;  InterPro: IPR011625 This is a domain of the alpha-2-macroglobulin family. The alpha-macroglobulin (aM) family of proteins includes protease inhibitors [], typified by the human tetrameric a2-macroglobulin (a2M); they belong to the MEROPS proteinase inhibitor family I39, clan IL. These protease inhibitors share several defining properties, which include (i) the ability to inhibit proteases from all catalytic classes, (ii) the presence of a 'bait region' and a thiol ester, (iii) a similar protease inhibitory mechanism and (iv) the inactivation of the inhibitory capacity by reaction of the thiol ester with small primary amines. aM protease inhibitors inhibit by steric hindrance []. The mechanism involves protease cleavage of the bait region, a segment of the aM that is particularly susceptible to proteolytic cleavage, which initiates a conformational change such that the aM collapses about the protease. In the resulting aM-protease complex, the active site of the protease is sterically shielded, thus substantially decreasing access to protein substrates. Two additional events occur as a consequence of bait region cleavage, namely (i) the h-cysteinyl-g-glutamyl thiol ester becomes highly reactive and (ii) a major conformational change exposes a conserved COOH-terminal receptor binding domain [] (RBD). RBD exposure allows the aM protease complex to bind to clearance receptors and be removed from circulation []. Tetrameric, dimeric, and, more recently, monomeric aM protease inhibitors have been identified [, ].; PDB: 2QKI_D 3L3O_D 3NMS_A 2ICF_A 2A73_A 2ICE_D 2HR0_A 2A74_A 2XWJ_G 3OHX_A ....
Probab=24.74  E-value=1.4e+02  Score=21.90  Aligned_cols=17  Identities=6%  Similarity=0.243  Sum_probs=14.8

Q ss_pred             CCCCCcEEEEEEeeecC
Q 029551          145 DIRTGDVVEIKLFLKIG  161 (191)
Q Consensus       145 diRpGdIVelklEVPEn  161 (191)
                      .++|||.+++.+.-|..
T Consensus         9 ~~~~Ge~~~v~v~~~~~   25 (136)
T PF07703_consen    9 SYKPGETAKVTVQSPFP   25 (136)
T ss_dssp             SB-TTSEEEEEEEEESC
T ss_pred             CcCCCCEEEEEEEcCCC
Confidence            57899999999999988


No 64 
>PF09874 DUF2101:  Predicted membrane protein (DUF2101);  InterPro: IPR018663  This family of conserved hypothetical proteins has no known function. 
Probab=24.62  E-value=61  Score=28.62  Aligned_cols=16  Identities=38%  Similarity=0.771  Sum_probs=14.0

Q ss_pred             CCCCCCCCcEEEEEEe
Q 029551          142 PIPDIRTGDVVEIKLF  157 (191)
Q Consensus       142 ~iPdiRpGdIVelklE  157 (191)
                      ..||+.+||+|.|.||
T Consensus       178 ~~~d~~~G~vVKl~VE  193 (206)
T PF09874_consen  178 AVPDVEEGDVVKLLVE  193 (206)
T ss_pred             CCCCCCCCceEEEEEe
Confidence            3679999999999987


No 65 
>PF11213 DUF3006:  Protein of unknown function (DUF3006);  InterPro: IPR021377  This family of proteins has no known function. 
Probab=24.38  E-value=76  Score=22.50  Aligned_cols=12  Identities=42%  Similarity=0.637  Sum_probs=10.3

Q ss_pred             CCCCCCCcEEEE
Q 029551          143 IPDIRTGDVVEI  154 (191)
Q Consensus       143 iPdiRpGdIVel  154 (191)
                      -+++|.|||+++
T Consensus        31 P~~~keGDvl~i   42 (71)
T PF11213_consen   31 PEGAKEGDVLEI   42 (71)
T ss_pred             CCCCCcccEEEE
Confidence            357999999999


No 66 
>PF12238 MSA-2c:  Merozoite surface antigen 2c;  InterPro: IPR021060  This family of proteins are restricted to the apicomplexan Babesia bovis. Proteins in this entry are typically between 263 and 318 amino acids in length and plasma membrane glycoproteins. These antigens present on the merozoite surface (MSA) and are involved in the parasite invasion of the bovine erythrocyte. MSA-2c has been suggested as a possible antigen for a vaccine candidate [].
Probab=23.64  E-value=35  Score=29.80  Aligned_cols=12  Identities=58%  Similarity=1.093  Sum_probs=9.7

Q ss_pred             CceeEEeecceecC
Q 029551          178 GSTLQFEFGGLLLA  191 (191)
Q Consensus       178 gstf~~~~~~~~~~  191 (191)
                      ||+|||  |||-.|
T Consensus       194 gsSFTf--GGLTVA  205 (205)
T PF12238_consen  194 GSSFTF--GGLTVA  205 (205)
T ss_pred             CCceec--CCcccC
Confidence            999885  998765


No 67 
>cd03452 MaoC_C MaoC_C  The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein. Orthologs of MaoC include PaaZ [Escherichia coli] and PaaN [Pseudomonas putida], which are putative ring-opening enzymes involved in phenylacetic acid degradation. The C-terminal domain of MaoC has sequence similarity to (R)-specific enoyl-CoA hydratase,Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.  MaoC also has an N-terminal PutA domain like that found in the E. coli PutA proline dehydrogenase and other members of the aldehyde dehydrogenase family.
Probab=23.52  E-value=1.1e+02  Score=23.47  Aligned_cols=22  Identities=23%  Similarity=0.439  Sum_probs=16.5

Q ss_pred             CCCCCCCCCcEEEEEEeeecCC
Q 029551          141 RPIPDIRTGDVVEIKLFLKIGV  162 (191)
Q Consensus       141 R~iPdiRpGdIVelklEVPEnk  162 (191)
                      |=.=++++||.|.++++|-+-+
T Consensus        84 rf~~PV~~GDtl~~~~~V~~~~  105 (142)
T cd03452          84 RFLEPVYPGDTIQVRLTCKRKI  105 (142)
T ss_pred             EECCCCCCCCEEEEEEEEEEEe
Confidence            3344578999999999997553


No 68 
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif in ribosomal proteins, NusG, Spt5p, KIN17 and T54.
Probab=23.38  E-value=70  Score=17.76  Aligned_cols=12  Identities=25%  Similarity=0.468  Sum_probs=8.9

Q ss_pred             CCCCCcEEEEEE
Q 029551          145 DIRTGDVVEIKL  156 (191)
Q Consensus       145 diRpGdIVelkl  156 (191)
                      .+++||.|+|.-
T Consensus         1 ~~~~G~~V~I~~   12 (28)
T smart00739        1 KFEVGDTVRVIA   12 (28)
T ss_pred             CCCCCCEEEEeE
Confidence            368899888753


No 69 
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]
Probab=22.20  E-value=59  Score=28.24  Aligned_cols=14  Identities=29%  Similarity=0.643  Sum_probs=11.9

Q ss_pred             CCCCCCcEEEEEEe
Q 029551          144 PDIRTGDVVEIKLF  157 (191)
Q Consensus       144 PdiRpGdIVelklE  157 (191)
                      =.|||||||+-||=
T Consensus       117 d~f~~GDivrA~Vi  130 (188)
T COG1096         117 DAFRIGDIVRARVI  130 (188)
T ss_pred             cccccccEEEEEEE
Confidence            57999999998764


No 70 
>COG0186 RpsQ Ribosomal protein S17 [Translation, ribosomal structure and biogenesis]
Probab=22.00  E-value=1.6e+02  Score=22.80  Aligned_cols=30  Identities=20%  Similarity=0.275  Sum_probs=25.9

Q ss_pred             CCCCCcEEEEEEeeecCCCCcceeeEEEee
Q 029551          145 DIRTGDVVEIKLFLKIGVGCPFTKVLLCQG  174 (191)
Q Consensus       145 diRpGdIVelklEVPEnkRR~~t~~~ic~~  174 (191)
                      +.+.||+|+|.=-.|-.|.--|..+.|.-.
T Consensus        55 ~~k~GD~V~I~EtRPLSKtK~~~vv~i~~~   84 (87)
T COG0186          55 EAKVGDIVRIAETRPLSKTKRFVVVEIVEK   84 (87)
T ss_pred             cCCCCCEEEEEEccccCCcceEEEEEEeee
Confidence            478999999999999999988888887654


No 71 
>PF14801 GCD14_N:  tRNA methyltransferase complex GCD14 subunit N-term; PDB: 1I9G_A.
Probab=21.79  E-value=61  Score=23.28  Aligned_cols=35  Identities=26%  Similarity=0.316  Sum_probs=17.9

Q ss_pred             CCCCCcEEEEEEeeecCCCCcceeeEEEeeccCCceeEEeecce
Q 029551          145 DIRTGDVVEIKLFLKIGVGCPFTKVLLCQGKMLGSTLQFEFGGL  188 (191)
Q Consensus       145 diRpGdIVelklEVPEnkRR~~t~~~ic~~~glgstf~~~~~~~  188 (191)
                      +||.||-|||.    ..|+|-.|+++.-     |-.|+...|.+
T Consensus         5 pf~~GdrVQlT----D~Kgr~~Ti~L~~-----G~~fhThrG~i   39 (54)
T PF14801_consen    5 PFRAGDRVQLT----DPKGRKHTITLEP-----GGEFHTHRGAI   39 (54)
T ss_dssp             S--TT-EEEEE----ETT--EEEEE--T-----T-EEEETTEEE
T ss_pred             CCCCCCEEEEc----cCCCCeeeEEECC-----CCeEEcCcccc
Confidence            68999988875    6788888877653     44555555443


No 72 
>PF13437 HlyD_3:  HlyD family secretion protein
Probab=21.70  E-value=2.3e+02  Score=19.94  Aligned_cols=44  Identities=23%  Similarity=0.305  Sum_probs=28.6

Q ss_pred             cCCCCCCC-CCcEEEEEEeeecCCCCcceeeEEEeecc---CCceeEEee
Q 029551          140 ERPIPDIR-TGDVVEIKLFLKIGVGCPFTKVLLCQGKM---LGSTLQFEF  185 (191)
Q Consensus       140 ~R~iPdiR-pGdIVelklEVPEnkRR~~t~~~ic~~~g---lgstf~~~~  185 (191)
                      ++.+.-|+ +|+-|.+++. + +......++..-|...   -+.+|++++
T Consensus        44 ~~~~~~i~~~g~~v~v~~~-~-~~~~~~~g~V~~I~~~~~~~~~~~~v~~   91 (105)
T PF13437_consen   44 EKDIARIKDPGQKVTVRLD-P-GPEKTIEGKVSSISPSPDPQGGTYRVEI   91 (105)
T ss_pred             hHhhcceEeCCCEEEEEEC-C-CCCcEEEEEEEEEeCcccCCCcEEEEEE
Confidence            45566777 9999999998 3 3333777777777532   233666654


No 73 
>PF02752 Arrestin_C:  Arrestin (or S-antigen), C-terminal domain;  InterPro: IPR011022 G protein-coupled receptors are a large family of signalling molecules that respond to a wide variety of extracellular stimuli. The receptors relay the information encoded by the ligand through the activation of heterotrimeric G proteins and intracellular effector molecules. To ensure the appropriate regulation of the signalling cascade, it is vital to properly inactivate the receptor. This inactivation is achieved, in part, by the binding of a soluble protein, arrestin, which uncouples the receptor from the downstream G protein after the receptors are phosphorylated by G protein-coupled receptor kinases. In addition to the inactivation of G protein-coupled receptors, arrestins have also been implicated in the endocytosis of receptors and cross talk with other signalling pathways. Arrestin (retinal S-antigen) is a major protein of the retinal rod outer segments. It interacts with photo-activated phosphorylated rhodopsin, inhibiting or 'arresting' its ability to interact with transducin []. The protein binds calcium, and shows similarity in its C terminus to alpha-transducin and other purine nucleotide-binding proteins. In mammals, arrestin is associated with autoimmune uveitis. Arrestins comprise a family of closely-related proteins that includes beta-arrestin-1 and -2, which regulate the function of beta-adrenergic receptors by binding to their phosphorylated forms, impairing their capacity to activate G(S) proteins; Cone photoreceptors C-arrestin (arrestin-X) [], which could bind to phosphorylated red/green opsins; and Drosophila phosrestins I and II, which undergo light-induced phosphorylation, and probably play a role in photoreceptor transduction [, , ].  The crystal structure of bovine retinal arrestin comprises two domains of antiparallel beta-sheets connected through a hinge region and one short alpha-helix on the back of the amino-terminal fold []. The binding region for phosphorylated light-activated rhodopsin is located at the N-terminal domain, as indicated by the docking of the photoreceptor to the three-dimensional structure of arrestin.  The C-terminal domain consists of an immunoglobulin-like beta-sandwich structure. This entry represents proteins with immunoglobulin-like domains that are similar to those found in arrestin.; PDB: 1SUJ_A 3UGX_A 1CF1_B 1AYR_A 3UGU_A 3P2D_B 1ZSH_A 2WTR_B 3GC3_A 1G4R_A ....
Probab=21.32  E-value=1.7e+02  Score=20.74  Aligned_cols=22  Identities=5%  Similarity=0.096  Sum_probs=14.5

Q ss_pred             CCCCcEEEEEEeeecCCCCcce
Q 029551          146 IRTGDVVEIKLFLKIGVGCPFT  167 (191)
Q Consensus       146 iRpGdIVelklEVPEnkRR~~t  167 (191)
                      +.|||.|.+.+++-++..+...
T Consensus        16 ~~~Ge~i~v~v~i~n~s~~~i~   37 (136)
T PF02752_consen   16 YVPGETIPVNVEIDNQSKKKIK   37 (136)
T ss_dssp             EETT--EEEEEEEEE-SSSEEE
T ss_pred             ECCCCEEEEEEEEEECCCCEEE
Confidence            5699999999999966665433


No 74 
>PF01835 A2M_N:  MG2 domain;  InterPro: IPR002890 The proteinase-binding alpha-macroglobulins (A2M) [] are large glycoproteins found in the plasma of vertebrates, in the hemolymph of some invertebrates and in reptilian and avian egg white. A2M-like proteins are able to inhibit all four classes of proteinases by a 'trapping' mechanism. They have a peptide stretch, called the 'bait region', which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein, thus trapping the proteinase. The entrapped enzyme remains active against low molecular weight substrates, whilst its activity toward larger substrates is greatly reduced, due to steric hindrance. Following cleavage in the bait region, a thiol ester bond, formed between the side chains of a cysteine and a glutamine, is cleaved and mediates the covalent binding of the A2M-like protein to the proteinase. This family includes the N-terminal region of the alpha-2-macroglobulin family. The inhibitor domains belong to MEROPS inhibitor family I39.; GO: 0004866 endopeptidase inhibitor activity; PDB: 2B39_B 3KLS_B 3PRX_C 3KM9_B 3PVM_C 3CU7_A 4E0S_A 4A5W_A 4ACQ_C 2P9R_B ....
Probab=21.32  E-value=82  Score=22.24  Aligned_cols=17  Identities=18%  Similarity=0.261  Sum_probs=12.6

Q ss_pred             CCCCCcEEEEEEeeecC
Q 029551          145 DIRTGDVVEIKLFLKIG  161 (191)
Q Consensus       145 diRpGdIVelklEVPEn  161 (191)
                      =.||||.|.+|+-+=..
T Consensus        10 iYrPGetV~~~~~~~~~   26 (99)
T PF01835_consen   10 IYRPGETVHFRAIVRDL   26 (99)
T ss_dssp             EE-TTSEEEEEEEEEEE
T ss_pred             CcCCCCEEEEEEEEecc
Confidence            36999999999996533


No 75 
>PF15493 YrpD:  Domain of unknown function, YrpD
Probab=20.93  E-value=93  Score=27.61  Aligned_cols=33  Identities=12%  Similarity=0.260  Sum_probs=25.6

Q ss_pred             CCCCCCCCcEEEEEEeeec--CCCCcceeeEEEee
Q 029551          142 PIPDIRTGDVVEIKLFLKI--GVGCPFTKVLLCQG  174 (191)
Q Consensus       142 ~iPdiRpGdIVelklEVPE--nkRR~~t~~~ic~~  174 (191)
                      =-+.|+||-.|||++-+|-  |-|-...+..+|--
T Consensus        92 Y~ngf~pGqdVqm~~y~n~nGn~Rltl~Gta~c~d  126 (208)
T PF15493_consen   92 YKNGFKPGQDVQMTLYKNYNGNTRLTLWGTAICAD  126 (208)
T ss_pred             ecCCCCCCCeEEEEEEEeCCCCEEEEEEeeeeccc
Confidence            3589999999999999993  44556777777753


No 76 
>COG1813 Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription]
Probab=20.83  E-value=29  Score=29.46  Aligned_cols=48  Identities=31%  Similarity=0.327  Sum_probs=38.6

Q ss_pred             hhhhcCCCCCCccchhhHHHHhhHHHHHHhhhcCCCCCC---CCCcEEEEE
Q 029551          108 EEEEVKAPRKPRVKLGDIMGILNKRAVEASESERPIPDI---RTGDVVEIK  155 (191)
Q Consensus       108 eeeE~~~prkkrkk~g~IM~ILnkeavee~~~~R~iPdi---RpGdIVelk  155 (191)
                      |-.+.+|--+-.+||-.+.+|+-.|.+++....-.-.+.   -=||||.||
T Consensus       113 E~g~~~P~~~~akkLEk~LgIkL~e~~~~~~~~~~~~~~~~~TLGdiv~ik  163 (165)
T COG1813         113 ERGEATPNIKVAKKLEKLLGIKLVEKVDEEEEGPKGKDDDGLTLGDIVRIK  163 (165)
T ss_pred             HhcccCccHHHHHHHHHHhCceeeeeccccccccccCCcCCCcccceEEec
Confidence            777778888888999999999999998888777444444   459999987


No 77 
>PTZ00274 cytochrome b5 reductase; Provisional
Probab=20.77  E-value=1e+02  Score=27.60  Aligned_cols=11  Identities=18%  Similarity=0.471  Sum_probs=9.5

Q ss_pred             CCCCCcEEEEE
Q 029551          145 DIRTGDVVEIK  155 (191)
Q Consensus       145 diRpGdIVelk  155 (191)
                      ++++||.|+|+
T Consensus       136 ~lk~Gd~v~v~  146 (325)
T PTZ00274        136 GMHVGDKLLFR  146 (325)
T ss_pred             cCCCCCEEEEe
Confidence            46999999997


No 78 
>PRK08916 flagellar motor switch protein; Reviewed
Probab=20.72  E-value=89  Score=24.91  Aligned_cols=32  Identities=9%  Similarity=0.137  Sum_probs=19.9

Q ss_pred             CCCCCCCCcEEEEE------EeeecCCCCcceeeEEEe
Q 029551          142 PIPDIRTGDVVEIK------LFLKIGVGCPFTKVLLCQ  173 (191)
Q Consensus       142 ~iPdiRpGdIVelk------lEVPEnkRR~~t~~~ic~  173 (191)
                      .+=.+++||||.|.      +++=-|.+..+.+....+
T Consensus        62 ELL~L~~GDVI~Ld~~~~e~V~I~Vng~~~~~Gelg~~   99 (116)
T PRK08916         62 QLLKLGPGSVLELDRKVGEAIDIYVNNRLVARGEVVLV   99 (116)
T ss_pred             HHhcCCCCCEEEcCCCCCCCEEEEECCEEEEEEEEEEE
Confidence            34468999999996      444445555555444444


No 79 
>PRK08559 nusG transcription antitermination protein NusG; Validated
Probab=20.56  E-value=82  Score=25.14  Aligned_cols=12  Identities=42%  Similarity=0.786  Sum_probs=10.6

Q ss_pred             CCCCCCcEEEEE
Q 029551          144 PDIRTGDVVEIK  155 (191)
Q Consensus       144 PdiRpGdIVelk  155 (191)
                      -++++||.|+|+
T Consensus        93 ~~~~~G~~V~I~  104 (153)
T PRK08559         93 EGIKEGDIVELI  104 (153)
T ss_pred             cCCCCCCEEEEe
Confidence            579999999986


No 80 
>cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. RpoE is subunit E of archaeal RNA polymerase. Archaeal cells contain a single RNA polymerase made up of 12 subunits, which are homologous to the 12 subunits (RPB1-12) of eukaryotic RNA polymerase II. RpoE is homologous to Rpa43 of eukaryotic RNA polymerase I, RPB7 of eukaryotic RNA polymerase II, and Rpc25 of eukaryotic RNA polymerase III. RpoE is composed of two domains, the N-terminal RNP (ribonucleoprotein) domain and the C-terminal S1 domain. This S1 domain binds ssRNA and ssDNA. This family is classified based on the C-terminal S1 domain. The function of RpoE is not fully understood. In eukaryotes, RPB7 and RPB4 form a heterodimer that reversibly associates with the RNA polymerase II core.
Probab=20.36  E-value=1.5e+02  Score=21.45  Aligned_cols=33  Identities=24%  Similarity=0.220  Sum_probs=21.1

Q ss_pred             CCCCcEEEEEEeeecCCCC--cceeeEEEee-ccCC
Q 029551          146 IRTGDVVEIKLFLKIGVGC--PFTKVLLCQG-KMLG  178 (191)
Q Consensus       146 iRpGdIVelklEVPEnkRR--~~t~~~ic~~-~glg  178 (191)
                      ++.||.|++++.=-....|  ....+.+.+. .++|
T Consensus        54 ~~~Gd~v~vkI~~vd~~~~~~~~~~i~ls~k~~~~g   89 (99)
T cd04460          54 LKVGDVVRARIVAVSLKERRPRESKIGLTMRQPGLG   89 (99)
T ss_pred             ECCCCEEEEEEEEEeHHHCcCCCceEEEEEecCCCC
Confidence            7999999999976654322  2445555552 5554


No 81 
>cd03711 Tet_C Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O). This domain has homology to the C terminal domains of the elongation factors EF-G and EF-2. Tet(M) and Tet(O) catalyze the release of tetracycline (Tc) from the ribosome in a GTP-dependent manner thereby mediating Tc resistance.  Tcs are broad-spectrum antibiotics.  Typical Tcs bind to the ribosome and inhibit the elongation phase of protein synthesis, by inhibiting the  occupation of site A by aminoacyl-tRNA.
Probab=20.36  E-value=26  Score=24.42  Aligned_cols=61  Identities=26%  Similarity=0.365  Sum_probs=37.6

Q ss_pred             chhhHHHHhhHHHHHHhhhcCCCCCCCCCcEEEEEEeeecCCCCcceeeEEEeeccCCceeEEeecce
Q 029551          121 KLGDIMGILNKRAVEASESERPIPDIRTGDVVEIKLFLKIGVGCPFTKVLLCQGKMLGSTLQFEFGGL  188 (191)
Q Consensus       121 k~g~IM~ILnkeavee~~~~R~iPdiRpGdIVelklEVPEnkRR~~t~~~ic~~~glgstf~~~~~~~  188 (191)
                      -+|.||+.|+++.=+-..     ++.. ++.+.|+-++|-..=-.+.-.+..+++|-|+ |+++|.|.
T Consensus        14 ~~g~v~~~l~~rrg~i~~-----~~~~-~~~~~i~~~~P~~~~~g~~~~Lr~~T~G~~~-~~~~f~~y   74 (78)
T cd03711          14 ALGRAMSDLAKMGATFED-----PQIK-GDEVTLEGTIPVATSQDYQSELPSYTHGEGV-LETEFKGY   74 (78)
T ss_pred             HHHHHHHHHHHcCCEeeC-----cEec-CCEEEEEEEECHHHHhhHHHHhHhhcCCeEE-EEEEeCCe
Confidence            378899999876533221     2223 3678899999954433333334444567664 88888764


No 82 
>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (hs4) of the H. sapiens RPS1 homolog. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=20.31  E-value=1.4e+02  Score=18.75  Aligned_cols=20  Identities=25%  Similarity=0.363  Sum_probs=14.1

Q ss_pred             CCCCCcEEEEEEeeecCCCC
Q 029551          145 DIRTGDVVEIKLFLKIGVGC  164 (191)
Q Consensus       145 diRpGdIVelklEVPEnkRR  164 (191)
                      -++.||.|++++.=-+.+++
T Consensus        44 ~~~~Gd~v~v~v~~~~~~~~   63 (69)
T cd05692          44 VLKEGDKVKVKVLSIDARGR   63 (69)
T ss_pred             ccCCCCEEEEEEEEECCCCc
Confidence            37999999999844443443


No 83 
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair]
Probab=20.23  E-value=97  Score=31.72  Aligned_cols=25  Identities=28%  Similarity=0.418  Sum_probs=21.2

Q ss_pred             HhhhcCCCCCCCCCcEEEEEEeeec
Q 029551          136 ASESERPIPDIRTGDVVEIKLFLKI  160 (191)
Q Consensus       136 e~~~~R~iPdiRpGdIVelklEVPE  160 (191)
                      +....|.-|+|++||||++.=+|--
T Consensus       249 e~aGvRAyP~IevGdiV~ViG~V~~  273 (715)
T COG1107         249 EEAGVRAYPEIEVGDIVEVIGEVTR  273 (715)
T ss_pred             ccCCcccCCCCCCCceEEEEEEEee
Confidence            3468899999999999999887753


No 84 
>PRK14560 putative RNA-binding protein; Provisional
Probab=20.03  E-value=1.7e+02  Score=23.45  Aligned_cols=26  Identities=23%  Similarity=0.052  Sum_probs=18.1

Q ss_pred             CCCCCCcEEEEEEeeecCCCCcceeeEEEe
Q 029551          144 PDIRTGDVVEIKLFLKIGVGCPFTKVLLCQ  173 (191)
Q Consensus       144 PdiRpGdIVelklEVPEnkRR~~t~~~ic~  173 (191)
                      ++|++||+|.|..+   ++ .....+|+|.
T Consensus       105 ~~~~~Gd~V~I~~~---~~-~~~vavG~~~  130 (160)
T PRK14560        105 EDIKEGDIVFVVEE---TH-GKPLAVGRAL  130 (160)
T ss_pred             CCCCCCCEEEEEEC---CC-CeEEEEEEEe
Confidence            69999999999874   22 3345666655


Done!