Query         029557
Match_columns 191
No_of_seqs    153 out of 190
Neff          4.2 
Searched_HMMs 46136
Date          Fri Mar 29 14:49:43 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/029557.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/029557hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05605 zf-Di19:  Drought indu  99.8 2.1E-20 4.6E-25  127.3   3.6   54   47-100     1-54  (54)
  2 PF14571 Di19_C:  Stress-induce  99.8 6.9E-20 1.5E-24  141.3   4.1   59  119-177     1-61  (105)
  3 KOG1280 Uncharacterized conser  98.6 2.1E-08 4.6E-13   91.8   3.6   57   25-88     63-120 (381)
  4 COG5216 Uncharacterized conser  94.9  0.0096 2.1E-07   43.0   0.6   33   47-88     21-55  (67)
  5 KOG2923 Uncharacterized conser  94.8   0.015 3.3E-07   42.3   1.6   46   31-88      8-55  (67)
  6 PF13894 zf-C2H2_4:  C2H2-type   94.6   0.023   5E-07   30.9   1.6   23   49-71      1-24  (24)
  7 PF09237 GAGA:  GAGA factor;  I  93.4   0.038 8.3E-07   38.7   1.1   27   75-101    22-50  (54)
  8 PLN03086 PRLI-interacting fact  92.6    0.11 2.5E-06   50.7   3.6   46   47-97    452-498 (567)
  9 PF13913 zf-C2HC_2:  zinc-finge  91.9    0.11 2.5E-06   30.5   1.6   21   48-68      2-22  (25)
 10 PF00096 zf-C2H2:  Zinc finger,  91.6   0.075 1.6E-06   29.5   0.6   21   49-69      1-22  (23)
 11 COG5236 Uncharacterized conser  91.4    0.19 4.2E-06   47.3   3.4   55   43-105   217-311 (493)
 12 PF12756 zf-C2H2_2:  C2H2 type   90.2    0.12 2.6E-06   36.6   0.8   48   50-97      1-72  (100)
 13 PHA00732 hypothetical protein   90.0    0.36 7.8E-06   35.6   3.2   43   49-96      2-45  (79)
 14 KOG2462 C2H2-type Zn-finger pr  88.1    0.34 7.4E-06   43.8   2.3   35   47-85    160-195 (279)
 15 PF14354 Lar_restr_allev:  Rest  88.0    0.13 2.8E-06   35.0  -0.4   31   48-85      3-37  (61)
 16 smart00531 TFIIE Transcription  87.4    0.45 9.8E-06   38.2   2.4   37   47-88     98-134 (147)
 17 PHA00733 hypothetical protein   87.3    0.76 1.7E-05   36.5   3.6   50   47-100    72-124 (128)
 18 PF13909 zf-H2C2_5:  C2H2-type   87.3     0.3 6.4E-06   27.5   0.9   24   49-72      1-24  (24)
 19 PF08271 TF_Zn_Ribbon:  TFIIB z  87.1    0.18   4E-06   32.7  -0.0   34   49-92      1-34  (43)
 20 PRK09710 lar restriction allev  87.0    0.22 4.7E-06   36.1   0.3   32   47-87      5-37  (64)
 21 TIGR01206 lysW lysine biosynth  86.9    0.21 4.5E-06   34.8   0.2   30   48-86      2-31  (54)
 22 smart00834 CxxC_CXXC_SSSS Puta  85.8    0.26 5.6E-06   30.8   0.2   33   47-87      4-36  (41)
 23 PHA02768 hypothetical protein;  85.1    0.76 1.6E-05   32.3   2.2   34   48-85      5-39  (55)
 24 PLN03086 PRLI-interacting fact  84.9    0.81 1.8E-05   45.0   3.1   38   47-87    477-514 (567)
 25 PF09986 DUF2225:  Uncharacteri  83.0    0.33 7.2E-06   41.4  -0.3   19   47-65      4-22  (214)
 26 TIGR02098 MJ0042_CXXC MJ0042 f  82.5       1 2.2E-05   28.1   1.9   32   49-86      3-34  (38)
 27 PF12756 zf-C2H2_2:  C2H2 type   82.0    0.87 1.9E-05   32.2   1.6   26   48-73     50-76  (100)
 28 PLN03208 E3 ubiquitin-protein   81.6    0.52 1.1E-05   40.5   0.4   43   47-89     17-80  (193)
 29 COG1655 Uncharacterized protei  81.1    0.55 1.2E-05   42.0   0.4   14   46-59     17-30  (267)
 30 KOG2462 C2H2-type Zn-finger pr  80.9     1.6 3.4E-05   39.6   3.2   85   48-139   187-275 (279)
 31 PF12760 Zn_Tnp_IS1595:  Transp  80.5    0.81 1.7E-05   30.1   0.9   14   43-56     13-26  (46)
 32 TIGR02605 CxxC_CxxC_SSSS putat  80.1     1.1 2.3E-05   29.6   1.4   31   47-85      4-34  (52)
 33 smart00734 ZnF_Rad18 Rad18-lik  79.7     1.4 3.1E-05   26.1   1.7   20   49-68      2-21  (26)
 34 PF08274 PhnA_Zn_Ribbon:  PhnA   79.1    0.67 1.4E-05   28.8   0.1   25   50-86      4-28  (30)
 35 KOG1842 FYVE finger-containing  78.5     0.9 1.9E-05   43.9   0.9   34   42-77     11-45  (505)
 36 PF14255 Cys_rich_CPXG:  Cystei  78.4    0.67 1.5E-05   32.1   0.0   12   49-60      1-12  (52)
 37 smart00504 Ubox Modified RING   78.1     2.2 4.7E-05   28.4   2.5   26   56-88     21-46  (63)
 38 PRK14892 putative transcriptio  76.9    0.89 1.9E-05   35.2   0.3   34   47-89     20-54  (99)
 39 cd00350 rubredoxin_like Rubred  76.4     1.2 2.6E-05   27.5   0.7   24   49-85      2-25  (33)
 40 PRK00398 rpoP DNA-directed RNA  75.7     1.7 3.7E-05   28.4   1.4   29   48-87      3-31  (46)
 41 PF04780 DUF629:  Protein of un  73.6     1.9   4E-05   41.6   1.6   42   47-88     56-101 (466)
 42 PF14206 Cys_rich_CPCC:  Cystei  72.9     1.5 3.3E-05   32.7   0.7   24   49-83      2-26  (78)
 43 PF13912 zf-C2H2_6:  C2H2-type   72.7     2.3 5.1E-05   24.2   1.3   23   49-71      2-25  (27)
 44 TIGR03655 anti_R_Lar restricti  71.8     1.7 3.6E-05   29.4   0.6    7   50-56      3-9   (53)
 45 PHA00616 hypothetical protein   71.8       2 4.4E-05   28.9   1.0   25   49-73      2-27  (44)
 46 KOG3623 Homeobox transcription  71.5     1.2 2.5E-05   45.7  -0.3   40   47-86    209-249 (1007)
 47 PF05129 Elf1:  Transcription e  70.9     1.6 3.4E-05   32.4   0.4   33   47-86     21-55  (81)
 48 PF03470 zf-XS:  XS zinc finger  70.9     2.9 6.3E-05   28.2   1.6   23   80-102     1-23  (43)
 49 smart00355 ZnF_C2H2 zinc finge  70.8     3.8 8.2E-05   21.8   1.9   20   49-68      1-21  (26)
 50 cd00729 rubredoxin_SM Rubredox  70.7     2.1 4.5E-05   26.9   0.8   26   48-86      2-27  (34)
 51 PTZ00255 60S ribosomal protein  70.6       2 4.3E-05   33.0   0.8   13   47-59     35-48  (90)
 52 PF05207 zf-CSL:  CSL zinc fing  68.0       2 4.4E-05   29.6   0.4   47   31-89      4-52  (55)
 53 PF07191 zinc-ribbons_6:  zinc-  67.8    0.36 7.7E-06   35.5  -3.6   55   50-108     3-64  (70)
 54 PF07754 DUF1610:  Domain of un  67.5     3.1 6.7E-05   24.8   1.1   10   47-56     15-24  (24)
 55 PRK03976 rpl37ae 50S ribosomal  66.0     2.7 5.8E-05   32.3   0.7   10   47-56     35-44  (90)
 56 PF09723 Zn-ribbon_8:  Zinc rib  65.7       3 6.4E-05   27.1   0.8   31   47-85      4-34  (42)
 57 TIGR00280 L37a ribosomal prote  65.4     2.8   6E-05   32.3   0.7   10   47-56     34-43  (91)
 58 PF12773 DZR:  Double zinc ribb  65.3       4 8.7E-05   26.6   1.4   27   50-88     14-40  (50)
 59 COG4888 Uncharacterized Zn rib  64.7       3 6.4E-05   32.9   0.8   35   47-86     21-55  (104)
 60 PF15616 TerY-C:  TerY-C metal   64.3     2.1 4.5E-05   34.8  -0.1   39   49-89     78-117 (131)
 61 PRK12495 hypothetical protein;  64.2     4.3 9.3E-05   35.9   1.7   29   47-88     41-69  (226)
 62 PRK14890 putative Zn-ribbon RN  63.8     4.7  0.0001   28.8   1.6   31   47-84     24-55  (59)
 63 COG5175 MOT2 Transcriptional r  63.7     3.8 8.2E-05   38.8   1.4   36   51-87     17-63  (480)
 64 PF02176 zf-TRAF:  TRAF-type zi  63.2     2.5 5.5E-05   28.1   0.1   46   47-94      8-60  (60)
 65 KOG2932 E3 ubiquitin ligase in  63.0     2.9 6.2E-05   39.1   0.5   57   49-105    91-177 (389)
 66 PF05605 zf-Di19:  Drought indu  62.9     4.3 9.4E-05   27.2   1.2   25   47-72     30-54  (54)
 67 smart00659 RPOLCX RNA polymera  62.3     4.6  0.0001   26.8   1.2   28   48-87      2-29  (44)
 68 PF07282 OrfB_Zn_ribbon:  Putat  61.3     6.3 0.00014   27.2   1.9   38   47-96     27-65  (69)
 69 PF03145 Sina:  Seven in absent  61.1     5.5 0.00012   33.0   1.8   54   47-103    13-75  (198)
 70 PF13465 zf-H2C2_2:  Zinc-finge  61.0     2.4 5.1E-05   24.7  -0.3   11   48-58     14-24  (26)
 71 PF01780 Ribosomal_L37ae:  Ribo  60.8       3 6.4E-05   32.1   0.1   10   47-56     34-43  (90)
 72 PRK06266 transcription initiat  59.4     7.5 0.00016   32.5   2.3   32   47-88    116-147 (178)
 73 PF13395 HNH_4:  HNH endonuclea  59.1     5.2 0.00011   27.0   1.1   14   51-64      1-14  (54)
 74 TIGR00373 conserved hypothetic  58.7     7.4 0.00016   31.8   2.2   31   47-87    108-138 (158)
 75 PF09538 FYDLN_acid:  Protein o  58.5     6.1 0.00013   30.9   1.5   30   47-89      8-38  (108)
 76 PF04564 U-box:  U-box domain;   57.7     7.5 0.00016   27.6   1.8   36   47-88      3-50  (73)
 77 KOG0320 Predicted E3 ubiquitin  57.6     5.3 0.00011   34.4   1.1   47   43-89    126-179 (187)
 78 PF14616 DUF4451:  Domain of un  57.4     6.6 0.00014   31.1   1.6   27   77-103    25-56  (124)
 79 PF06957 COPI_C:  Coatomer (COP  56.6     4.4 9.5E-05   38.6   0.5   36   44-92    376-412 (422)
 80 COG4311 SoxD Sarcosine oxidase  55.8     5.3 0.00012   31.2   0.8    9   48-56      3-11  (97)
 81 PRK12496 hypothetical protein;  53.6     8.5 0.00018   31.7   1.7   27   48-87    127-153 (164)
 82 COG1592 Rubrerythrin [Energy p  52.6     9.5 0.00021   32.1   1.9   25   48-86    134-158 (166)
 83 PF10571 UPF0547:  Uncharacteri  52.6     8.4 0.00018   23.0   1.1    8   51-58      3-10  (26)
 84 KOG0402 60S ribosomal protein   52.2     4.5 9.7E-05   31.1  -0.1   11   46-56     34-44  (92)
 85 PRK00420 hypothetical protein;  52.2     9.9 0.00021   30.1   1.8   28   48-87     23-50  (112)
 86 PF11672 DUF3268:  Protein of u  51.0     7.5 0.00016   30.3   0.9   38   49-89      3-43  (102)
 87 PF12230 PRP21_like_P:  Pre-mRN  51.0     5.1 0.00011   34.1   0.0   21   77-97    168-189 (229)
 88 PF08209 Sgf11:  Sgf11 (transcr  50.5     8.1 0.00018   24.5   0.9   20   48-67      4-23  (33)
 89 COG0675 Transposase and inacti  50.5      10 0.00022   32.0   1.7   35   47-97    308-342 (364)
 90 PF10058 DUF2296:  Predicted in  50.0     8.8 0.00019   26.5   1.1    9   48-56     44-52  (54)
 91 PF13248 zf-ribbon_3:  zinc-rib  49.8      11 0.00024   22.1   1.3   10   49-58      3-12  (26)
 92 PRK03922 hypothetical protein;  48.4     8.8 0.00019   30.7   1.0   14   48-61     49-62  (113)
 93 KOG2231 Predicted E3 ubiquitin  47.7      12 0.00025   37.8   1.9   27   48-74    182-209 (669)
 94 PRK11088 rrmA 23S rRNA methylt  47.5     5.6 0.00012   34.2  -0.3   32   48-79      2-34  (272)
 95 PF13719 zinc_ribbon_5:  zinc-r  47.2      16 0.00034   23.1   1.8   29   49-85      3-33  (37)
 96 PF04475 DUF555:  Protein of un  47.0     9.4  0.0002   30.0   0.9   14   48-61     47-60  (102)
 97 PF08996 zf-DNA_Pol:  DNA Polym  46.0     3.1 6.7E-05   34.7  -2.0   39   48-88     18-56  (188)
 98 TIGR00100 hypA hydrogenase nic  45.9     7.4 0.00016   30.2   0.2   27   47-86     69-95  (115)
 99 smart00451 ZnF_U1 U1-like zinc  45.6      18 0.00038   21.4   1.8   22   48-69      3-25  (35)
100 PF02146 SIR2:  Sir2 family;  I  45.2      13 0.00029   30.0   1.6   40   48-92    105-144 (178)
101 PF14446 Prok-RING_1:  Prokaryo  44.3      14 0.00031   25.9   1.4   25   49-86      6-30  (54)
102 smart00507 HNHc HNH nucleases.  43.8     5.1 0.00011   24.7  -0.8   21   49-69     11-31  (52)
103 PF04981 NMD3:  NMD3 family ;    43.8      15 0.00033   31.5   1.8   35   51-85      1-43  (236)
104 PF14279 HNH_5:  HNH endonuclea  43.7     5.5 0.00012   28.9  -0.8   40   51-95      1-48  (71)
105 TIGR00570 cdk7 CDK-activating   42.7      12 0.00026   34.5   1.0   38   48-86      3-52  (309)
106 PF12171 zf-C2H2_jaz:  Zinc-fin  42.0      18  0.0004   20.7   1.4   20   49-68      2-22  (27)
107 TIGR00686 phnA alkylphosphonat  41.7      11 0.00025   29.9   0.7   25   50-86      4-28  (109)
108 TIGR02300 FYDLN_acid conserved  41.0      16 0.00035   29.8   1.5   28   47-87      8-36  (129)
109 KOG2879 Predicted E3 ubiquitin  40.9     7.8 0.00017   35.5  -0.4   41   47-87    238-286 (298)
110 KOG2817 Predicted E3 ubiquitin  40.9      17 0.00036   34.6   1.7   15   47-61    373-387 (394)
111 COG4049 Uncharacterized protei  40.4       9 0.00019   27.6  -0.1   27   78-104    18-46  (65)
112 PRK11595 DNA utilization prote  40.1      15 0.00032   31.2   1.2   33   50-84      7-41  (227)
113 KOG2177 Predicted E3 ubiquitin  40.0     9.8 0.00021   30.3   0.1   36   47-84     12-54  (386)
114 PF13824 zf-Mss51:  Zinc-finger  39.9      14  0.0003   26.1   0.8   10   47-56     13-22  (55)
115 PF14353 CpXC:  CpXC protein     39.5      15 0.00033   28.3   1.1   28   48-79     38-65  (128)
116 PF12013 DUF3505:  Protein of u  38.9      21 0.00046   26.8   1.8   32   72-103     6-38  (109)
117 PF00097 zf-C3HC4:  Zinc finger  38.5      16 0.00034   22.4   0.8    9   75-83     33-41  (41)
118 PRK12380 hydrogenase nickel in  37.8      13 0.00029   28.8   0.5   27   47-86     69-95  (113)
119 COG1499 NMD3 NMD protein affec  37.3      17 0.00037   33.9   1.2   39   47-85      5-51  (355)
120 PRK03824 hypA hydrogenase nick  37.0      15 0.00033   29.4   0.7   40   47-86     69-116 (135)
121 PF04423 Rad50_zn_hook:  Rad50   36.6      12 0.00025   25.2  -0.0   14   50-63     22-35  (54)
122 smart00661 RPOL9 RNA polymeras  35.8      16 0.00034   23.7   0.5   27   50-85      2-28  (52)
123 KOG3576 Ovo and related transc  35.6      15 0.00033   32.7   0.6   61   49-112   146-213 (267)
124 PRK05477 gatB aspartyl/glutamy  35.3      18 0.00038   35.0   1.0   22   67-88     27-48  (474)
125 PF01155 HypA:  Hydrogenase exp  35.1     9.2  0.0002   29.5  -0.8   27   47-86     69-95  (113)
126 COG5109 Uncharacterized conser  34.9      19 0.00041   33.9   1.1   11   47-57    375-385 (396)
127 COG5189 SFP1 Putative transcri  34.7      21 0.00045   33.8   1.3   40   48-87    349-408 (423)
128 PF04780 DUF629:  Protein of un  34.6      16 0.00035   35.4   0.6   48   57-104    20-86  (466)
129 PRK04023 DNA polymerase II lar  34.4      19 0.00041   38.3   1.1    9   78-86    664-672 (1121)
130 COG2888 Predicted Zn-ribbon RN  33.9      22 0.00048   25.7   1.1   31   47-84     26-57  (61)
131 KOG3608 Zn finger proteins [Ge  33.5      37 0.00081   32.5   2.8   48   48-96    263-313 (467)
132 PF02892 zf-BED:  BED zinc fing  33.4      17 0.00038   22.9   0.4   25   47-71     15-44  (45)
133 cd00730 rubredoxin Rubredoxin;  33.3      22 0.00047   24.3   0.9   12   43-56     31-42  (50)
134 PF12230 PRP21_like_P:  Pre-mRN  33.1      14 0.00031   31.4   0.0   23   48-70    168-190 (229)
135 PF12660 zf-TFIIIC:  Putative z  32.3     8.3 0.00018   29.4  -1.4   38   50-87     16-65  (99)
136 PRK00907 hypothetical protein;  31.8      22 0.00049   27.0   0.9   28   37-67      5-34  (92)
137 PHA00733 hypothetical protein   31.2      39 0.00085   26.7   2.2   25   48-72     99-124 (128)
138 COG2331 Uncharacterized protei  31.2      11 0.00025   28.4  -0.8   46   47-105    11-56  (82)
139 PF05876 Terminase_GpA:  Phage   30.7      24 0.00052   34.3   1.1   40   47-88    199-240 (557)
140 TIGR00515 accD acetyl-CoA carb  30.7      28 0.00061   31.4   1.4   30   43-86     25-54  (285)
141 PF03966 Trm112p:  Trm112p-like  30.5      28 0.00061   24.3   1.2   38   47-85      6-61  (68)
142 COG1675 TFA1 Transcription ini  30.2      28 0.00061   29.5   1.3   29   47-87    112-142 (176)
143 KOG4696 Uncharacterized conser  30.2      28 0.00062   32.6   1.4   23   49-72      3-25  (393)
144 PF09862 DUF2089:  Protein of u  30.0      12 0.00026   29.7  -0.8   39   51-104     1-54  (113)
145 PF04267 SoxD:  Sarcosine oxida  30.0      14 0.00031   27.9  -0.5    8   49-56      2-9   (84)
146 KOG3993 Transcription factor (  29.8      15 0.00032   35.7  -0.5   33   47-79    457-490 (500)
147 PLN02751 glutamyl-tRNA(Gln) am  29.8      25 0.00053   34.7   1.0   21   68-88     84-104 (544)
148 PF01844 HNH:  HNH endonuclease  29.7     7.4 0.00016   24.4  -1.8   11   51-61      1-11  (47)
149 PF14311 DUF4379:  Domain of un  29.6      35 0.00075   22.8   1.4   29   47-83     27-55  (55)
150 cd03019 DsbA_DsbA DsbA family,  29.6      20 0.00043   27.7   0.3   19   47-65     23-42  (178)
151 PF11290 DUF3090:  Protein of u  29.3      27 0.00059   29.7   1.1   13   49-61    155-167 (171)
152 TIGR01374 soxD sarcosine oxida  29.2      25 0.00054   26.7   0.7    8   49-56      2-9   (84)
153 PF00301 Rubredoxin:  Rubredoxi  29.2      27 0.00058   23.6   0.8   10   47-56     33-42  (47)
154 PF10276 zf-CHCC:  Zinc-finger   29.2      21 0.00045   23.5   0.2    9   48-56     29-37  (40)
155 PF12874 zf-met:  Zinc-finger o  28.7      34 0.00074   18.8   1.1   16   80-95      3-20  (25)
156 PF09706 Cas_CXXC_CXXC:  CRISPR  28.6      21 0.00046   25.5   0.3   10   47-56      4-13  (69)
157 TIGR03830 CxxCG_CxxCG_HTH puta  28.1      18 0.00038   27.2  -0.3   37   51-87      1-41  (127)
158 cd03021 DsbA_GSTK DsbA family,  28.1      13 0.00028   30.6  -1.1   13   43-57      5-17  (209)
159 PF09334 tRNA-synt_1g:  tRNA sy  28.0      14 0.00031   34.1  -0.9   40   49-88    137-177 (391)
160 CHL00174 accD acetyl-CoA carbo  27.8      38 0.00081   31.0   1.8   29   43-85     37-65  (296)
161 TIGR00133 gatB glutamyl-tRNA(G  27.5      29 0.00062   33.6   1.0   15   74-88     34-48  (478)
162 COG4391 Uncharacterized protei  27.4      28 0.00061   25.2   0.7   13   74-86     45-57  (62)
163 PRK10220 hypothetical protein;  27.4      31 0.00068   27.5   1.0   13   74-86     17-29  (111)
164 COG4049 Uncharacterized protei  27.4      29 0.00062   25.1   0.7   27   47-73     16-43  (65)
165 PHA02565 49 recombination endo  27.4      26 0.00055   29.5   0.6   41   47-87     19-65  (157)
166 KOG2593 Transcription initiati  27.1      20 0.00043   34.5  -0.1   32   47-85    127-161 (436)
167 COG3058 FdhE Uncharacterized p  27.0      23 0.00051   32.6   0.3   18   76-93    184-201 (308)
168 PRK09678 DNA-binding transcrip  26.9      29 0.00063   25.5   0.7    8   49-56      2-9   (72)
169 PF14369 zf-RING_3:  zinc-finge  26.8      31 0.00067   21.8   0.7    9   50-58     23-31  (35)
170 PRK14714 DNA polymerase II lar  26.8      32  0.0007   37.3   1.3   36   48-88    667-703 (1337)
171 PF13462 Thioredoxin_4:  Thiore  26.3     6.1 0.00013   30.1  -3.1   21   47-67     20-41  (162)
172 PF13717 zinc_ribbon_4:  zinc-r  26.3      50  0.0011   20.8   1.6   31   49-85      3-33  (36)
173 cd03024 DsbA_FrnE DsbA family,  26.1      18 0.00038   28.9  -0.6   21   47-67      5-26  (201)
174 PRK03681 hypA hydrogenase nick  26.0      22 0.00048   27.6  -0.1   12   47-58     69-80  (114)
175 PRK05654 acetyl-CoA carboxylas  25.7      39 0.00084   30.6   1.4   30   43-86     26-55  (292)
176 COG1997 RPL43A Ribosomal prote  25.6      23  0.0005   27.3  -0.0   13   43-57     32-44  (89)
177 PHA02929 N1R/p28-like protein;  25.4      13 0.00028   32.9  -1.6   41   47-87    173-226 (238)
178 PF02934 GatB_N:  GatB/GatE cat  25.2      28  0.0006   31.7   0.4   23   66-88     21-43  (289)
179 smart00614 ZnF_BED BED zinc fi  24.3      39 0.00085   22.2   0.9   25   48-72     18-48  (50)
180 cd02972 DsbA_family DsbA famil  24.3      19 0.00041   24.1  -0.6   18   47-64      5-23  (98)
181 COG1198 PriA Primosomal protei  24.0      30 0.00066   35.2   0.5   38   47-86    443-484 (730)
182 cd03022 DsbA_HCCA_Iso DsbA fam  23.7      18 0.00038   28.5  -1.0   20   47-66      5-25  (192)
183 PRK00564 hypA hydrogenase nick  23.7      30 0.00066   26.9   0.3   28   47-86     70-97  (117)
184 PF03604 DNA_RNApol_7kD:  DNA d  23.6      36 0.00077   21.3   0.6   11   77-87     17-27  (32)
185 PRK00423 tfb transcription ini  23.5      47   0.001   29.7   1.5   38   47-94     10-47  (310)
186 PF09889 DUF2116:  Uncharacteri  23.5      44 0.00096   23.7   1.1   10   50-59      5-14  (59)
187 PRK00464 nrdR transcriptional   23.4      34 0.00074   28.3   0.6   31   50-86      2-37  (154)
188 PHA02540 61 DNA primase; Provi  23.0      37 0.00081   31.4   0.8    9   48-56     27-35  (337)
189 PF15135 UPF0515:  Uncharacteri  22.9      39 0.00085   30.7   0.9   17   43-59    150-166 (278)
190 PF14634 zf-RING_5:  zinc-RING   22.6      50  0.0011   21.0   1.2   20   63-84     24-43  (44)
191 COG2761 FrnE Predicted dithiol  22.3      29 0.00063   30.6   0.0   53   43-102    10-70  (225)
192 PF06676 DUF1178:  Protein of u  22.0      41 0.00089   27.9   0.8   10   76-85     31-40  (148)
193 PF08273 Prim_Zn_Ribbon:  Zinc-  22.0      38 0.00083   22.2   0.5    8   49-56      4-11  (40)
194 PF06221 zf-C2HC5:  Putative zi  21.9      44 0.00096   23.6   0.8    9   48-56     35-43  (57)
195 PRK00762 hypA hydrogenase nick  21.9      30 0.00065   27.3  -0.0    8   49-56     93-100 (124)
196 COG1656 Uncharacterized conser  21.8      66  0.0014   27.3   2.0   39   50-88     99-141 (165)
197 TIGR01405 polC_Gram_pos DNA po  21.6      57  0.0012   35.1   2.0   47   28-86    670-717 (1213)
198 PF13453 zf-TFIIB:  Transcripti  21.0      25 0.00054   22.4  -0.5   10   51-60      2-11  (41)
199 PRK11639 zinc uptake transcrip  20.8      72  0.0016   26.1   2.0   41   47-87     99-150 (169)
200 cd01407 SIR2-fam SIR2 family o  20.4      68  0.0015   26.9   1.8   35   48-87    109-143 (218)
201 KOG3608 Zn finger proteins [Ge  20.3      71  0.0015   30.7   2.1   56   48-103   319-380 (467)
202 smart00586 ZnF_DBF Zinc finger  20.3      41 0.00089   23.1   0.4   28   74-102     2-30  (49)
203 KOG3214 Uncharacterized Zn rib  20.2      43 0.00094   26.6   0.6   34   47-85     22-55  (109)
204 TIGR00244 transcriptional regu  20.2      43 0.00094   27.8   0.6   32   50-88      2-39  (147)
205 PF14968 CCDC84:  Coiled coil p  20.2      44 0.00095   31.1   0.7   22   47-68     57-85  (336)
206 KOG4080 Mitochondrial ribosoma  20.1      44 0.00096   28.6   0.7   25   48-88     93-117 (176)

No 1  
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=99.80  E-value=2.1e-20  Score=127.32  Aligned_cols=54  Identities=37%  Similarity=0.864  Sum_probs=52.0

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcccchHhhhhcccc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHG  100 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~~d~v~Hl~~qH~  100 (191)
                      ++|+||||+++||+.+|+.|++++|..+.++||||||+.+++.||++||+.+|+
T Consensus         1 ~~f~CP~C~~~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~~l~~Hl~~~H~   54 (54)
T PF05605_consen    1 DSFTCPYCGKGFSESSLVEHCEDEHRSESKNVVCPICSSRVTDNLIRHLNSQHR   54 (54)
T ss_pred             CCcCCCCCCCccCHHHHHHHHHhHCcCCCCCccCCCchhhhhhHHHHHHHHhcC
Confidence            369999999999999999999999999999999999999999999999999996


No 2  
>PF14571 Di19_C:  Stress-induced protein Di19, C-terminal
Probab=99.79  E-value=6.9e-20  Score=141.32  Aligned_cols=59  Identities=49%  Similarity=0.628  Sum_probs=53.8

Q ss_pred             cchhhhHHHHhhhhhhhhcCC-CCCCCCCCCCCCCccc-cccCCCCCCCcCCcCccCCcCC
Q 029557          119 TISSLRKELQNAHFQSLLARS-SSSVSSSKKTSDPWLS-FIYNMPTADESESIQPALSTGE  177 (191)
Q Consensus       119 ~~s~l~k~lre~~lq~llgg~-s~~~~~s~~~pDPLLS-Fi~~~~~~~~~~~~~~~~~~e~  177 (191)
                      |+|+|+|||||||||+||||+ +++++++|++|||||| ||||+|.++.++.+++..++++
T Consensus         1 tlsll~kelre~~LQsllGgs~~~~~~ssn~apDPLLSSFI~n~~~~~~~~~~~~~~~~~~   61 (105)
T PF14571_consen    1 TLSLLRKELREGYLQSLLGGSRSSSSSSSNSAPDPLLSSFICNFPAPEAEEPSKSSSSSEE   61 (105)
T ss_pred             CcchhhhhhhhhhhhhhcCCCcCCCCCCCCCCCcHHHHHHhcCCCCccccccCCccccccc
Confidence            689999999999999999998 6666789999999999 9999999999999998887663


No 3  
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only]
Probab=98.63  E-value=2.1e-08  Score=91.77  Aligned_cols=57  Identities=26%  Similarity=0.562  Sum_probs=51.7

Q ss_pred             cccccCCCCCCCcchhhhccCcceecCCCCCC-CcCHHHHHhhhhhcCCCCCCcccccccccCcc
Q 029557           25 FADFCIDFEDIEEDDYEEVKGEYEYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        25 ~d~~~~g~e~~e~d~d~e~~~~~~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      ||+ |+|+|-+--+++      ..|+||||++ +|....+.+|+..+|+.....+|||||+..+.
T Consensus        63 feL-~f~Ge~i~~y~~------qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~~~~  120 (381)
T KOG1280|consen   63 FEL-YFGGEPISHYDP------QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAANPE  120 (381)
T ss_pred             eee-EecCcccccccc------ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccccCcc
Confidence            676 778888888888      7899999999 99999999999999999999999999999754


No 4  
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=94.86  E-value=0.0096  Score=42.99  Aligned_cols=33  Identities=33%  Similarity=0.841  Sum_probs=23.9

Q ss_pred             ceecCCCCCC--CcCHHHHHhhhhhcCCCCCCcccccccccCcc
Q 029557           47 YEYPCPFCSE--DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        47 ~~F~CPfC~e--~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      -+|||| ||.  ++.+..|..        .-..++||-|+-+|-
T Consensus        21 ftyPCP-CGDRFeIsLeDl~~--------GE~VArCPSCSLiv~   55 (67)
T COG5216          21 FTYPCP-CGDRFEISLEDLRN--------GEVVARCPSCSLIVC   55 (67)
T ss_pred             EEecCC-CCCEeEEEHHHhhC--------CceEEEcCCceEEEE
Confidence            489999 998  555555532        456789999988653


No 5  
>KOG2923 consensus Uncharacterized conserved protein [Function unknown]
Probab=94.85  E-value=0.015  Score=42.25  Aligned_cols=46  Identities=33%  Similarity=0.720  Sum_probs=29.2

Q ss_pred             CCCCCCcchhhhccCcceecCCCCCC--CcCHHHHHhhhhhcCCCCCCcccccccccCcc
Q 029557           31 DFEDIEEDDYEEVKGEYEYPCPFCSE--DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        31 g~e~~e~d~d~e~~~~~~F~CPfC~e--~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      .++|++-|+|. -.  .+|||| ||.  .+....|..        .-..+.||-|+-.+.
T Consensus         8 eiedfe~~~e~-~~--y~yPCp-CGDrf~It~edL~~--------ge~Va~CpsCSL~I~   55 (67)
T KOG2923|consen    8 EIEDFEFDEEN-QT--YYYPCP-CGDRFQITLEDLEN--------GEDVARCPSCSLIIR   55 (67)
T ss_pred             EeecceeccCC-Ce--EEcCCC-CCCeeeecHHHHhC--------CCeeecCCCceEEEE
Confidence            45565544331 22  589999 998  455555532        445689999988664


No 6  
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=94.62  E-value=0.023  Score=30.88  Aligned_cols=23  Identities=26%  Similarity=0.593  Sum_probs=17.2

Q ss_pred             ecCCCCCC-CcCHHHHHhhhhhcC
Q 029557           49 YPCPFCSE-DFDLVGLCCHIDEEH   71 (191)
Q Consensus        49 F~CPfC~e-~~D~~~L~~H~~eeH   71 (191)
                      |.||+|+. --+...|..|+...|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            78999999 667888888888766


No 7  
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=93.36  E-value=0.038  Score=38.74  Aligned_cols=27  Identities=19%  Similarity=0.575  Sum_probs=18.3

Q ss_pred             CCcccccccccCcc--cchHhhhhccccc
Q 029557           75 AKSGVCPVCVTRVT--MDMVDHITTQHGN  101 (191)
Q Consensus        75 ~k~vVCPICa~~~~--~d~v~Hl~~qH~~  101 (191)
                      .....||+|.+.+.  +|+-+||-+.|+.
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            34679999998765  7999999988874


No 8  
>PLN03086 PRLI-interacting factor K; Provisional
Probab=92.63  E-value=0.11  Score=50.75  Aligned_cols=46  Identities=24%  Similarity=0.455  Sum_probs=36.6

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcc-cchHhhhhc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT-MDMVDHITT   97 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~-~d~v~Hl~~   97 (191)
                      .-+.||+|++.|....|-.|....|    +.+.|| |..... .+|..|++.
T Consensus       452 ~H~~C~~Cgk~f~~s~LekH~~~~H----kpv~Cp-Cg~~~~R~~L~~H~~t  498 (567)
T PLN03086        452 NHVHCEKCGQAFQQGEMEKHMKVFH----EPLQCP-CGVVLEKEQMVQHQAS  498 (567)
T ss_pred             cCccCCCCCCccchHHHHHHHHhcC----CCccCC-CCCCcchhHHHhhhhc
Confidence            3468999999899999999999866    678999 965433 588888764


No 9  
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=91.86  E-value=0.11  Score=30.51  Aligned_cols=21  Identities=33%  Similarity=0.661  Sum_probs=18.8

Q ss_pred             eecCCCCCCCcCHHHHHhhhh
Q 029557           48 EYPCPFCSEDFDLVGLCCHID   68 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~   68 (191)
                      ..+||+||..|....|-.|..
T Consensus         2 l~~C~~CgR~F~~~~l~~H~~   22 (25)
T PF13913_consen    2 LVPCPICGRKFNPDRLEKHEK   22 (25)
T ss_pred             CCcCCCCCCEECHHHHHHHHH
Confidence            468999999999999999964


No 10 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=91.61  E-value=0.075  Score=29.46  Aligned_cols=21  Identities=29%  Similarity=0.611  Sum_probs=15.0

Q ss_pred             ecCCCCCC-CcCHHHHHhhhhh
Q 029557           49 YPCPFCSE-DFDLVGLCCHIDE   69 (191)
Q Consensus        49 F~CPfC~e-~~D~~~L~~H~~e   69 (191)
                      |.||.|++ =-+...|..|+..
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            67888888 4556677777765


No 11 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=91.41  E-value=0.19  Score=47.35  Aligned_cols=55  Identities=27%  Similarity=0.447  Sum_probs=42.1

Q ss_pred             ccCcceecCCCCCC-CcCHHHHHhhhhhcCCCCCCcccccccccC-------------------------------cc--
Q 029557           43 VKGEYEYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVTR-------------------------------VT--   88 (191)
Q Consensus        43 ~~~~~~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~~-------------------------------~~--   88 (191)
                      .+||  =.|-||.. =+|-.+|..||...|-      .|-||..+                               ++  
T Consensus       217 FKGH--P~C~FC~~~FYdDDEL~~HcR~~HE------~ChICD~v~p~~~QYFK~Y~~Le~HF~~~hy~ct~qtc~~~k~  288 (493)
T COG5236         217 FKGH--PLCIFCKIYFYDDDELRRHCRLRHE------ACHICDMVGPIRYQYFKSYEDLEAHFRNAHYCCTFQTCRVGKC  288 (493)
T ss_pred             cCCC--chhhhccceecChHHHHHHHHhhhh------hhhhhhccCccchhhhhCHHHHHHHhhcCceEEEEEEEecCcE
Confidence            5543  46999999 8899999999999884      46666442                               11  


Q ss_pred             ------cchHhhhhcccccchhh
Q 029557           89 ------MDMVDHITTQHGNISNS  105 (191)
Q Consensus        89 ------~d~v~Hl~~qH~~~~K~  105 (191)
                            ..++.||+..|+..+|.
T Consensus       289 ~vf~~~~el~~h~~~~h~~~~~~  311 (493)
T COG5236         289 YVFPYHTELLEHLTRFHKVNARL  311 (493)
T ss_pred             EEeccHHHHHHHHHHHhhccccc
Confidence                  46888999999999884


No 12 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=90.23  E-value=0.12  Score=36.64  Aligned_cols=48  Identities=25%  Similarity=0.554  Sum_probs=14.0

Q ss_pred             cCCCCCCC-cCHHHHHhhhhhcCCCCCC---------------------cccccccccCc--ccchHhhhhc
Q 029557           50 PCPFCSED-FDLVGLCCHIDEEHPVEAK---------------------SGVCPVCVTRV--TMDMVDHITT   97 (191)
Q Consensus        50 ~CPfC~e~-~D~~~L~~H~~eeH~~e~k---------------------~vVCPICa~~~--~~d~v~Hl~~   97 (191)
                      -|+||+.. -++..|..|+...|.+...                     ...|++|....  ...+..||..
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             ------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHH
T ss_pred             CccccccccccccccccccccccccccccccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcC
Confidence            39999994 5688999999999987432                     13499998764  3688999864


No 13 
>PHA00732 hypothetical protein
Probab=90.04  E-value=0.36  Score=35.63  Aligned_cols=43  Identities=28%  Similarity=0.652  Sum_probs=32.7

Q ss_pred             ecCCCCCC-CcCHHHHHhhhhhcCCCCCCcccccccccCcccchHhhhh
Q 029557           49 YPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHIT   96 (191)
Q Consensus        49 F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~~d~v~Hl~   96 (191)
                      |.|+.|+. --....|..|....|..    ..|++|...-. ++..|+.
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~~----~~C~~CgKsF~-~l~~H~~   45 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHTL----TKCPVCNKSYR-RLNQHFY   45 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccCC----CccCCCCCEeC-Chhhhhc
Confidence            88999999 44788899999866653    26999977553 5777763


No 14 
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=88.11  E-value=0.34  Score=43.81  Aligned_cols=35  Identities=20%  Similarity=0.552  Sum_probs=24.0

Q ss_pred             ceecCCCCCC-CcCHHHHHhhhhhcCCCCCCccccccccc
Q 029557           47 YEYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVT   85 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~   85 (191)
                      ..|.||+|++ .+.+..|--|+... .   -.-+|+||-.
T Consensus       160 ka~~C~~C~K~YvSmpALkMHirTH-~---l~c~C~iCGK  195 (279)
T KOG2462|consen  160 KAFSCKYCGKVYVSMPALKMHIRTH-T---LPCECGICGK  195 (279)
T ss_pred             ccccCCCCCceeeehHHHhhHhhcc-C---CCcccccccc
Confidence            4688888888 88888888887643 2   2346667654


No 15 
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=87.96  E-value=0.13  Score=35.02  Aligned_cols=31  Identities=26%  Similarity=0.559  Sum_probs=19.4

Q ss_pred             eecCCCCCC-CcCHHHHHhhhhhcCCCCC---Cccccccccc
Q 029557           48 EYPCPFCSE-DFDLVGLCCHIDEEHPVEA---KSGVCPVCVT   85 (191)
Q Consensus        48 ~F~CPfC~e-~~D~~~L~~H~~eeH~~e~---k~vVCPICa~   85 (191)
                      .-+|||||. .+.+..       ....+.   -.|.|..|.+
T Consensus         3 LkPCPFCG~~~~~~~~-------~~~~~~~~~~~V~C~~Cga   37 (61)
T PF14354_consen    3 LKPCPFCGSADVLIRQ-------DEGFDYGMYYYVECTDCGA   37 (61)
T ss_pred             CcCCCCCCCcceEeec-------ccCCCCCCEEEEEcCCCCC
Confidence            458999997 554332       222222   4577999977


No 16 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=87.45  E-value=0.45  Score=38.18  Aligned_cols=37  Identities=22%  Similarity=0.530  Sum_probs=25.4

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      ..|.||.|+.-|+..+-....+   .  ....+||.|-..+-
T Consensus        98 ~~Y~Cp~C~~~y~~~ea~~~~d---~--~~~f~Cp~Cg~~l~  134 (147)
T smart00531       98 AYYKCPNCQSKYTFLEANQLLD---M--DGTFTCPRCGEELE  134 (147)
T ss_pred             cEEECcCCCCEeeHHHHHHhcC---C--CCcEECCCCCCEEE
Confidence            6899999999666554333322   1  34489999988653


No 17 
>PHA00733 hypothetical protein
Probab=87.28  E-value=0.76  Score=36.47  Aligned_cols=50  Identities=38%  Similarity=0.700  Sum_probs=35.7

Q ss_pred             ceecCCCCCCCc-CHHHHHhhhhhcCCCCCCcccccccccCc--ccchHhhhhcccc
Q 029557           47 YEYPCPFCSEDF-DLVGLCCHIDEEHPVEAKSGVCPVCVTRV--TMDMVDHITTQHG  100 (191)
Q Consensus        47 ~~F~CPfC~e~~-D~~~L~~H~~eeH~~e~k~vVCPICa~~~--~~d~v~Hl~~qH~  100 (191)
                      ..|.|+.|+..| ....|..|... |   .....|++|....  ..++..|+.--|+
T Consensus        72 kPy~C~~Cgk~Fss~s~L~~H~r~-h---~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         72 SPYVCPLCLMPFSSSVSLKQHIRY-T---EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCccCCCCCCcCCCHHHHHHHHhc-C---CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            369999999954 55668888874 2   1346999997653  3588889876665


No 18 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=87.26  E-value=0.3  Score=27.54  Aligned_cols=24  Identities=38%  Similarity=0.778  Sum_probs=16.0

Q ss_pred             ecCCCCCCCcCHHHHHhhhhhcCC
Q 029557           49 YPCPFCSEDFDLVGLCCHIDEEHP   72 (191)
Q Consensus        49 F~CPfC~e~~D~~~L~~H~~eeH~   72 (191)
                      |.||+|.-.-....|..|++..|+
T Consensus         1 y~C~~C~y~t~~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTSKSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EESHHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCCHHHHHHHHHhhCc
Confidence            678888883337788888887764


No 19 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=87.09  E-value=0.18  Score=32.66  Aligned_cols=34  Identities=24%  Similarity=0.556  Sum_probs=21.2

Q ss_pred             ecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcccchH
Q 029557           49 YPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMV   92 (191)
Q Consensus        49 F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~~d~v   92 (191)
                      |.||.|+... +      +.+   ......||+.|-..+..+.+
T Consensus         1 m~Cp~Cg~~~-~------~~D---~~~g~~vC~~CG~Vl~e~~i   34 (43)
T PF08271_consen    1 MKCPNCGSKE-I------VFD---PERGELVCPNCGLVLEENII   34 (43)
T ss_dssp             ESBTTTSSSE-E------EEE---TTTTEEEETTT-BBEE-TTB
T ss_pred             CCCcCCcCCc-e------EEc---CCCCeEECCCCCCEeecccc
Confidence            6899999843 2      122   34566899999777655444


No 20 
>PRK09710 lar restriction alleviation and modification protein; Reviewed
Probab=86.99  E-value=0.22  Score=36.14  Aligned_cols=32  Identities=25%  Similarity=0.523  Sum_probs=21.9

Q ss_pred             ceecCCCCCC-CcCHHHHHhhhhhcCCCCCCcccccccccCc
Q 029557           47 YEYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRV   87 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~   87 (191)
                      ..=||||||. .+.+.         |....-.++|.-|.+..
T Consensus         5 ~lKPCPFCG~~~~~v~---------~~~g~~~v~C~~CgA~~   37 (64)
T PRK09710          5 NVKPCPFCGCPSVTVK---------AISGYYRAKCNGCESRT   37 (64)
T ss_pred             cccCCCCCCCceeEEE---------ecCceEEEEcCCCCcCc
Confidence            3459999999 66554         22223359999998853


No 21 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=86.86  E-value=0.21  Score=34.82  Aligned_cols=30  Identities=20%  Similarity=0.574  Sum_probs=21.5

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      .|.||-||+.+.+....       .  .-.+.||.|.+.
T Consensus         2 ~~~CP~CG~~iev~~~~-------~--GeiV~Cp~CGae   31 (54)
T TIGR01206         2 QFECPDCGAEIELENPE-------L--GELVICDECGAE   31 (54)
T ss_pred             ccCCCCCCCEEecCCCc-------c--CCEEeCCCCCCE
Confidence            48999999977654332       1  336899999774


No 22 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=85.82  E-value=0.26  Score=30.79  Aligned_cols=33  Identities=30%  Similarity=0.735  Sum_probs=23.0

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRV   87 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~   87 (191)
                      .+|.||-||..|++..-.        .+...++||.|.+.+
T Consensus         4 Y~y~C~~Cg~~fe~~~~~--------~~~~~~~CP~Cg~~~   36 (41)
T smart00834        4 YEYRCEDCGHTFEVLQKI--------SDDPLATCPECGGDV   36 (41)
T ss_pred             EEEEcCCCCCEEEEEEec--------CCCCCCCCCCCCCcc
Confidence            579999999977643211        125678999998743


No 23 
>PHA02768 hypothetical protein; Provisional
Probab=85.07  E-value=0.76  Score=32.29  Aligned_cols=34  Identities=21%  Similarity=0.501  Sum_probs=25.5

Q ss_pred             eecCCCCCC-CcCHHHHHhhhhhcCCCCCCccccccccc
Q 029557           48 EYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVT   85 (191)
Q Consensus        48 ~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~   85 (191)
                      .|.||.||+ =.....|..|....+    ++-.|..|..
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~----k~~kc~~C~k   39 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN----TNLKLSNCKR   39 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC----CcccCCcccc
Confidence            489999999 556778999999844    4556777744


No 24 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=84.92  E-value=0.81  Score=44.96  Aligned_cols=38  Identities=18%  Similarity=0.314  Sum_probs=27.9

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRV   87 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~   87 (191)
                      ..+.|| |+..+....|..|.. .|+-. +...|+.|...+
T Consensus       477 kpv~Cp-Cg~~~~R~~L~~H~~-thCp~-Kpi~C~fC~~~v  514 (567)
T PLN03086        477 EPLQCP-CGVVLEKEQMVQHQA-STCPL-RLITCRFCGDMV  514 (567)
T ss_pred             CCccCC-CCCCcchhHHHhhhh-ccCCC-CceeCCCCCCcc
Confidence            457888 888778888888874 45553 667888887655


No 25 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=82.95  E-value=0.33  Score=41.43  Aligned_cols=19  Identities=21%  Similarity=0.642  Sum_probs=14.8

Q ss_pred             ceecCCCCCCCcCHHHHHh
Q 029557           47 YEYPCPFCSEDFDLVGLCC   65 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~   65 (191)
                      .+++||+|+..|....+..
T Consensus         4 k~~~CPvC~~~F~~~~vrs   22 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRS   22 (214)
T ss_pred             CceECCCCCCeeeeeEEEc
Confidence            4689999999998765443


No 26 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=82.53  E-value=1  Score=28.05  Aligned_cols=32  Identities=22%  Similarity=0.422  Sum_probs=19.9

Q ss_pred             ecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           49 YPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        49 F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      +.||.|+.-|.+..-.      .......+.||.|-..
T Consensus         3 ~~CP~C~~~~~v~~~~------~~~~~~~v~C~~C~~~   34 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQ------LGANGGKVRCGKCGHV   34 (38)
T ss_pred             EECCCCCCEEEeCHHH------cCCCCCEEECCCCCCE
Confidence            7899999955443211      1223346889999654


No 27 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=82.05  E-value=0.87  Score=32.17  Aligned_cols=26  Identities=27%  Similarity=0.737  Sum_probs=21.2

Q ss_pred             eecCCCCCCCc-CHHHHHhhhhhcCCC
Q 029557           48 EYPCPFCSEDF-DLVGLCCHIDEEHPV   73 (191)
Q Consensus        48 ~F~CPfC~e~~-D~~~L~~H~~eeH~~   73 (191)
                      .|.|++|++.| +...|..|+...|..
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~H~   76 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKHHK   76 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTTTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCccCC
Confidence            59999999965 899999999987543


No 28 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=81.59  E-value=0.52  Score=40.53  Aligned_cols=43  Identities=26%  Similarity=0.624  Sum_probs=27.4

Q ss_pred             ceecCCCCCCCcC--HHHHHhh-----hhhcCC--------------CCCCcccccccccCccc
Q 029557           47 YEYPCPFCSEDFD--LVGLCCH-----IDEEHP--------------VEAKSGVCPVCVTRVTM   89 (191)
Q Consensus        47 ~~F~CPfC~e~~D--~~~L~~H-----~~eeH~--------------~e~k~vVCPICa~~~~~   89 (191)
                      ..|.||.|.+.+.  +...|.|     |.....              ...+...||+|...+..
T Consensus        17 ~~~~CpICld~~~dPVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is~   80 (193)
T PLN03208         17 GDFDCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSE   80 (193)
T ss_pred             CccCCccCCCcCCCcEEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCCh
Confidence            5799999999333  3445666     233211              12345689999998864


No 29 
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=81.11  E-value=0.55  Score=41.98  Aligned_cols=14  Identities=29%  Similarity=0.888  Sum_probs=10.7

Q ss_pred             cceecCCCCCCCcC
Q 029557           46 EYEYPCPFCSEDFD   59 (191)
Q Consensus        46 ~~~F~CPfC~e~~D   59 (191)
                      ..++.||+|+--|-
T Consensus        17 kk~ieCPvC~tkFk   30 (267)
T COG1655          17 KKTIECPVCNTKFK   30 (267)
T ss_pred             hceeccCcccchhh
Confidence            36899999986553


No 30 
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=80.94  E-value=1.6  Score=39.60  Aligned_cols=85  Identities=26%  Similarity=0.377  Sum_probs=53.5

Q ss_pred             eecCCCCCCCcCHHHHH-hhhhhcCCCCCCcccccccccCcc--cchHhhhhcccccchhhhhhhcccCC-CCCccchhh
Q 029557           48 EYPCPFCSEDFDLVGLC-CHIDEEHPVEAKSGVCPVCVTRVT--MDMVDHITTQHGNISNSWHKLKLHKG-NSNSTISSL  123 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~-~H~~eeH~~e~k~vVCPICa~~~~--~d~v~Hl~~qH~~~~K~~rrrk~~k~-~s~s~~s~l  123 (191)
                      -+.|++||+-|+..=|. -|++ .|-.| |+-.||.|..--.  .|+-.||+. |+.. |   +-+..+= .+-+-.|+|
T Consensus       187 ~c~C~iCGKaFSRPWLLQGHiR-THTGE-KPF~C~hC~kAFADRSNLRAHmQT-HS~~-K---~~qC~~C~KsFsl~SyL  259 (279)
T KOG2462|consen  187 PCECGICGKAFSRPWLLQGHIR-THTGE-KPFSCPHCGKAFADRSNLRAHMQT-HSDV-K---KHQCPRCGKSFALKSYL  259 (279)
T ss_pred             CcccccccccccchHHhhcccc-cccCC-CCccCCcccchhcchHHHHHHHHh-hcCC-c---cccCcchhhHHHHHHHH
Confidence            58999999999987654 4554 46554 5679999966433  699999964 5554 2   1122221 133445677


Q ss_pred             hHHHHhhhhhhhhcCC
Q 029557          124 RKELQNAHFQSLLARS  139 (191)
Q Consensus       124 ~k~lre~~lq~llgg~  139 (191)
                      -|-+..|=+..+.|++
T Consensus       260 nKH~ES~C~~~~~g~~  275 (279)
T KOG2462|consen  260 NKHSESACLKYLAGVM  275 (279)
T ss_pred             HHhhhhccccccccCC
Confidence            7766665555554444


No 31 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=80.49  E-value=0.81  Score=30.07  Aligned_cols=14  Identities=21%  Similarity=0.764  Sum_probs=12.3

Q ss_pred             ccCcceecCCCCCC
Q 029557           43 VKGEYEYPCPFCSE   56 (191)
Q Consensus        43 ~~~~~~F~CPfC~e   56 (191)
                      +||...|.||+||.
T Consensus        13 ~RW~~g~~CP~Cg~   26 (46)
T PF12760_consen   13 IRWPDGFVCPHCGS   26 (46)
T ss_pred             hcCCCCCCCCCCCC
Confidence            78888899999996


No 32 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=80.09  E-value=1.1  Score=29.61  Aligned_cols=31  Identities=29%  Similarity=0.845  Sum_probs=22.0

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCccccccccc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVT   85 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~   85 (191)
                      .+|.|+-|+..|++.   ....     +...+.||.|..
T Consensus         4 Yey~C~~Cg~~fe~~---~~~~-----~~~~~~CP~Cg~   34 (52)
T TIGR02605         4 YEYRCTACGHRFEVL---QKMS-----DDPLATCPECGG   34 (52)
T ss_pred             EEEEeCCCCCEeEEE---EecC-----CCCCCCCCCCCC
Confidence            579999999988743   1111     245578999987


No 33 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=79.75  E-value=1.4  Score=26.15  Aligned_cols=20  Identities=25%  Similarity=0.572  Sum_probs=12.1

Q ss_pred             ecCCCCCCCcCHHHHHhhhh
Q 029557           49 YPCPFCSEDFDLVGLCCHID   68 (191)
Q Consensus        49 F~CPfC~e~~D~~~L~~H~~   68 (191)
                      ..||.|++.+....+-.|++
T Consensus         2 v~CPiC~~~v~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREVPENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcccHHHHHHHHH
Confidence            35666666666666666655


No 34 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=79.07  E-value=0.67  Score=28.83  Aligned_cols=25  Identities=28%  Similarity=0.870  Sum_probs=13.3

Q ss_pred             cCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           50 PCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        50 ~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      +||.|+.++..            .+....|||-|...
T Consensus         4 ~Cp~C~se~~y------------~D~~~~vCp~C~~e   28 (30)
T PF08274_consen    4 KCPLCGSEYTY------------EDGELLVCPECGHE   28 (30)
T ss_dssp             --TTT-----E------------E-SSSEEETTTTEE
T ss_pred             CCCCCCCccee------------ccCCEEeCCccccc
Confidence            68999886655            57778899999653


No 35 
>KOG1842 consensus FYVE finger-containing protein [General function prediction only]
Probab=78.51  E-value=0.9  Score=43.85  Aligned_cols=34  Identities=35%  Similarity=0.609  Sum_probs=29.1

Q ss_pred             hccCcceecCCCCCCCc-CHHHHHhhhhhcCCCCCCc
Q 029557           42 EVKGEYEYPCPFCSEDF-DLVGLCCHIDEEHPVEAKS   77 (191)
Q Consensus        42 e~~~~~~F~CPfC~e~~-D~~~L~~H~~eeH~~e~k~   77 (191)
                      +++  +-|-||+|.++| ++..|-+|++.+|..+-+.
T Consensus        11 ~i~--egflCPiC~~dl~~~~~L~~H~d~eH~~ed~~   45 (505)
T KOG1842|consen   11 EIL--EGFLCPICLLDLPNLSALNDHLDVEHFEEDEK   45 (505)
T ss_pred             hhh--hcccCchHhhhhhhHHHHHHHHhhhccccchh
Confidence            366  789999999977 4788999999999998764


No 36 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=78.38  E-value=0.67  Score=32.06  Aligned_cols=12  Identities=33%  Similarity=1.237  Sum_probs=9.4

Q ss_pred             ecCCCCCCCcCH
Q 029557           49 YPCPFCSEDFDL   60 (191)
Q Consensus        49 F~CPfC~e~~D~   60 (191)
                      +.|||||+.+++
T Consensus         1 i~CPyCge~~~~   12 (52)
T PF14255_consen    1 IQCPYCGEPIEI   12 (52)
T ss_pred             CCCCCCCCeeEE
Confidence            469999996654


No 37 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=78.10  E-value=2.2  Score=28.41  Aligned_cols=26  Identities=15%  Similarity=0.192  Sum_probs=17.9

Q ss_pred             CCcCHHHHHhhhhhcCCCCCCcccccccccCcc
Q 029557           56 EDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        56 e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      .-|+...+..++..       ...||+|.....
T Consensus        21 ~v~~~~~i~~~~~~-------~~~cP~~~~~~~   46 (63)
T smart00504       21 QTYERRAIEKWLLS-------HGTDPVTGQPLT   46 (63)
T ss_pred             CEEeHHHHHHHHHH-------CCCCCCCcCCCC
Confidence            34677777777755       358999977654


No 38 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=76.94  E-value=0.89  Score=35.22  Aligned_cols=34  Identities=15%  Similarity=0.405  Sum_probs=21.1

Q ss_pred             ceecCCCCCC-CcCHHHHHhhhhhcCCCCCCcccccccccCccc
Q 029557           47 YEYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTM   89 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~~   89 (191)
                      ..|.||||++ -+.       +.-.+  ..--++||+|-..-+.
T Consensus        20 t~f~CP~Cge~~v~-------v~~~k--~~~h~~C~~CG~y~~~   54 (99)
T PRK14892         20 KIFECPRCGKVSIS-------VKIKK--NIAIITCGNCGLYTEF   54 (99)
T ss_pred             cEeECCCCCCeEee-------eecCC--CcceEECCCCCCccCE
Confidence            5799999995 221       11112  2334899999876543


No 39 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=76.42  E-value=1.2  Score=27.53  Aligned_cols=24  Identities=42%  Similarity=0.888  Sum_probs=15.4

Q ss_pred             ecCCCCCCCcCHHHHHhhhhhcCCCCCCccccccccc
Q 029557           49 YPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVT   85 (191)
Q Consensus        49 F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~   85 (191)
                      |.|+.||--++...             ..-+||+|.+
T Consensus         2 ~~C~~CGy~y~~~~-------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE-------------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc-------------CCCcCcCCCC
Confidence            67888886433322             4568888865


No 40 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=75.69  E-value=1.7  Score=28.37  Aligned_cols=29  Identities=31%  Similarity=0.751  Sum_probs=19.5

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCc
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRV   87 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~   87 (191)
                      +|.||-||..|+....           .....||.|..++
T Consensus         3 ~y~C~~CG~~~~~~~~-----------~~~~~Cp~CG~~~   31 (46)
T PRK00398          3 EYKCARCGREVELDEY-----------GTGVRCPYCGYRI   31 (46)
T ss_pred             EEECCCCCCEEEECCC-----------CCceECCCCCCeE
Confidence            6889999986665211           1167899997654


No 41 
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=73.62  E-value=1.9  Score=41.60  Aligned_cols=42  Identities=29%  Similarity=0.420  Sum_probs=33.6

Q ss_pred             ceecCCCCCC-CcCHHHHHhhhhhcCCCCCCc---ccccccccCcc
Q 029557           47 YEYPCPFCSE-DFDLVGLCCHIDEEHPVEAKS---GVCPVCVTRVT   88 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~---vVCPICa~~~~   88 (191)
                      .--.||+|.+ -.|..++..|+..+|...-.+   -+.|-+....|
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~~~l~P~lqs~lPqrId~~w  101 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHPAGLKPKLQSVLPQRIDDDW  101 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhhhhcChhhhhhcCcccCHHH
Confidence            4678999999 999999999999999986543   46677666443


No 42 
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=72.86  E-value=1.5  Score=32.66  Aligned_cols=24  Identities=46%  Similarity=1.233  Sum_probs=17.1

Q ss_pred             ecCCCCCC-CcCHHHHHhhhhhcCCCCCCccccccc
Q 029557           49 YPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVC   83 (191)
Q Consensus        49 F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPIC   83 (191)
                      |+||-||. -|+..+           +...-|||||
T Consensus         2 ~~CPCCg~~Tl~~~~-----------~~~ydIC~VC   26 (78)
T PF14206_consen    2 YPCPCCGYYTLEERG-----------EGTYDICPVC   26 (78)
T ss_pred             ccCCCCCcEEeccCC-----------CcCceECCCC
Confidence            89999998 655322           2236699999


No 43 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=72.66  E-value=2.3  Score=24.16  Aligned_cols=23  Identities=22%  Similarity=0.335  Sum_probs=16.9

Q ss_pred             ecCCCCCC-CcCHHHHHhhhhhcC
Q 029557           49 YPCPFCSE-DFDLVGLCCHIDEEH   71 (191)
Q Consensus        49 F~CPfC~e-~~D~~~L~~H~~eeH   71 (191)
                      |.|..|++ =-+...|..|.+..|
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhc
Confidence            77888888 556778888876554


No 44 
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=71.82  E-value=1.7  Score=29.38  Aligned_cols=7  Identities=71%  Similarity=2.128  Sum_probs=6.6

Q ss_pred             cCCCCCC
Q 029557           50 PCPFCSE   56 (191)
Q Consensus        50 ~CPfC~e   56 (191)
                      +|||||-
T Consensus         3 PCPfCGg    9 (53)
T TIGR03655         3 PCPFCGG    9 (53)
T ss_pred             CCCCCCC
Confidence            7999998


No 45 
>PHA00616 hypothetical protein
Probab=71.80  E-value=2  Score=28.92  Aligned_cols=25  Identities=20%  Similarity=0.236  Sum_probs=19.5

Q ss_pred             ecCCCCCC-CcCHHHHHhhhhhcCCC
Q 029557           49 YPCPFCSE-DFDLVGLCCHIDEEHPV   73 (191)
Q Consensus        49 F~CPfC~e-~~D~~~L~~H~~eeH~~   73 (191)
                      |.||-||. =....+|..|+...|.-
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~   27 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQ   27 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCC
Confidence            67888888 55677888888777765


No 46 
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=71.47  E-value=1.2  Score=45.65  Aligned_cols=40  Identities=25%  Similarity=0.457  Sum_probs=35.0

Q ss_pred             ceecCCCCCC-CcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           47 YEYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      +..+||||.. .-.+..|..|+.-.|---.-+.-|+.|...
T Consensus       209 qlltcpycdrgykrltslkeHikyrhekne~nfsC~lCsyt  249 (1007)
T KOG3623|consen  209 QLLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYT  249 (1007)
T ss_pred             hhhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhh
Confidence            4689999999 667889999999999987778899999874


No 47 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=70.90  E-value=1.6  Score=32.41  Aligned_cols=33  Identities=24%  Similarity=0.566  Sum_probs=13.6

Q ss_pred             ceecCCCCC-C-CcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           47 YEYPCPFCS-E-DFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        47 ~~F~CPfC~-e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      ..|.||||+ + -+.+       .-......-.+.|-+|-..
T Consensus        21 ~~F~CPfC~~~~sV~v-------~idkk~~~~~~~C~~Cg~~   55 (81)
T PF05129_consen   21 KVFDCPFCNHEKSVSV-------KIDKKEGIGILSCRVCGES   55 (81)
T ss_dssp             S----TTT--SS-EEE-------EEETTTTEEEEEESSS--E
T ss_pred             ceEcCCcCCCCCeEEE-------EEEccCCEEEEEecCCCCe
Confidence            579999999 3 2222       1122233345789999653


No 48 
>PF03470 zf-XS:  XS zinc finger domain;  InterPro: IPR005381 This domain is a putative nucleic acid binding zinc finger and is found at the N terminus of proteins that also contain an adjacent XS domain IPR005380 from INTERPRO and in some proteins a C-terminal XH domain IPR005379 from INTERPRO.
Probab=70.87  E-value=2.9  Score=28.16  Aligned_cols=23  Identities=26%  Similarity=0.418  Sum_probs=13.4

Q ss_pred             ccccccCcccchHhhhhcccccc
Q 029557           80 CPVCVTRVTMDMVDHITTQHGNI  102 (191)
Q Consensus        80 CPICa~~~~~d~v~Hl~~qH~~~  102 (191)
                      ||.|..+.+.|+.=+-.+||..-
T Consensus         1 CP~C~~kkk~~Y~~~~LlqHA~g   23 (43)
T PF03470_consen    1 CPFCPGKKKQDYKYRELLQHASG   23 (43)
T ss_pred             CCCCCCCCCcceehhHHHHHHHh
Confidence            78887776644444444555443


No 49 
>smart00355 ZnF_C2H2 zinc finger.
Probab=70.85  E-value=3.8  Score=21.81  Aligned_cols=20  Identities=30%  Similarity=0.529  Sum_probs=13.6

Q ss_pred             ecCCCCCC-CcCHHHHHhhhh
Q 029557           49 YPCPFCSE-DFDLVGLCCHID   68 (191)
Q Consensus        49 F~CPfC~e-~~D~~~L~~H~~   68 (191)
                      |.|+.|+. =-....|..|+.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHH
Confidence            56788877 445567777766


No 50 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=70.70  E-value=2.1  Score=26.88  Aligned_cols=26  Identities=23%  Similarity=0.617  Sum_probs=16.9

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      .|.|+.||.-++...             ..-+||||-+.
T Consensus         2 ~~~C~~CG~i~~g~~-------------~p~~CP~Cg~~   27 (34)
T cd00729           2 VWVCPVCGYIHEGEE-------------APEKCPICGAP   27 (34)
T ss_pred             eEECCCCCCEeECCc-------------CCCcCcCCCCc
Confidence            478999987433221             23599999764


No 51 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=70.64  E-value=2  Score=33.02  Aligned_cols=13  Identities=38%  Similarity=1.088  Sum_probs=10.7

Q ss_pred             ceecCCCCCC-CcC
Q 029557           47 YEYPCPFCSE-DFD   59 (191)
Q Consensus        47 ~~F~CPfC~e-~~D   59 (191)
                      +.|+||||+. .+.
T Consensus        35 a~y~CpfCgk~~vk   48 (90)
T PTZ00255         35 AKYFCPFCGKHAVK   48 (90)
T ss_pred             CCccCCCCCCCcee
Confidence            7899999987 443


No 52 
>PF05207 zf-CSL:  CSL zinc finger;  InterPro: IPR007872 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a probable zinc binding motif that contains four cysteines and may chelate zinc, known as the DPH-type after the diphthamide (DPH) biosynthesis protein in which it was first characterised, including the proteins DPH3 and DPH4. This domain is also found associated with N-terminal domain of heat shock protein DnaJ IPR001623 from INTERPRO domain.  Diphthamide is a unique post-translationally modified histidine residue found only in translation elongation factor 2 (eEF-2). It is conserved from archaea to humans and serves as the target for diphteria toxin and Pseudomonas exotoxin A. These two toxins catalyse the transfer of ADP-ribose to diphtamide on eEF-2, thus inactivating eEF-2, halting cellular protein synthesis, and causing cell death []. The biosynthesis of diphtamide is dependent on at least five proteins, DPH1 to -5, and a still unidentified amidating enzyme. DPH3 and DPH4 share a conserved region, which encode a putative zinc finger, the DPH-type or CSL-type (after the conserved motif of the final cysteine) zinc finger [, ]. The function of this motif is unknown. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2L6L_A 1WGE_A 2JR7_A 1YOP_A 1YWS_A.
Probab=67.97  E-value=2  Score=29.58  Aligned_cols=47  Identities=28%  Similarity=0.553  Sum_probs=31.2

Q ss_pred             CCCCCCcchhhhccCcceecCCCCCC--CcCHHHHHhhhhhcCCCCCCcccccccccCccc
Q 029557           31 DFEDIEEDDYEEVKGEYEYPCPFCSE--DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTM   89 (191)
Q Consensus        31 g~e~~e~d~d~e~~~~~~F~CPfC~e--~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~~   89 (191)
                      .++|++.+++++.   -+|+|+ ||.  .+....|-.+        .-.|-|+-|+-.+..
T Consensus         4 ~l~d~~~~~~~~~---~~y~CR-CG~~f~i~e~~l~~~--------~~iv~C~sCSL~I~V   52 (55)
T PF05207_consen    4 SLDDMEFDEEEGV---YSYPCR-CGGEFEISEEDLEEG--------EVIVQCDSCSLWIRV   52 (55)
T ss_dssp             ETTTSEEETTTTE---EEEEET-TSSEEEEEHHHHHCT----------EEEETTTTEEEEE
T ss_pred             EhhhceecCCCCE---EEEcCC-CCCEEEEcchhccCc--------CEEEECCCCccEEEE
Confidence            3566666554334   389995 998  7777777666        445789999876643


No 53 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=67.83  E-value=0.36  Score=35.52  Aligned_cols=55  Identities=22%  Similarity=0.394  Sum_probs=24.0

Q ss_pred             cCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcc-------cchHhhhhcccccchhhhhh
Q 029557           50 PCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT-------MDMVDHITTQHGNISNSWHK  108 (191)
Q Consensus        50 ~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~-------~d~v~Hl~~qH~~~~K~~rr  108 (191)
                      .||-|...++..+-.-||..=+..=.+.+.||-|...+-       .|+.=    +|++-+|+++|
T Consensus         3 ~CP~C~~~L~~~~~~~~C~~C~~~~~~~a~CPdC~~~Le~LkACGAvdYFC----~~c~gLiSKkr   64 (70)
T PF07191_consen    3 TCPKCQQELEWQGGHYHCEACQKDYKKEAFCPDCGQPLEVLKACGAVDYFC----NHCHGLISKKR   64 (70)
T ss_dssp             B-SSS-SBEEEETTEEEETTT--EEEEEEE-TTT-SB-EEEEETTEEEEE-----TTTT-EE-TTT
T ss_pred             cCCCCCCccEEeCCEEECccccccceecccCCCcccHHHHHHHhcccceee----ccCCceeecce
Confidence            455555555555422222222222234588999988643       36653    47888876433


No 54 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=67.47  E-value=3.1  Score=24.76  Aligned_cols=10  Identities=40%  Similarity=1.168  Sum_probs=8.9

Q ss_pred             ceecCCCCCC
Q 029557           47 YEYPCPFCSE   56 (191)
Q Consensus        47 ~~F~CPfC~e   56 (191)
                      ..|+||-||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            6799999986


No 55 
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=66.04  E-value=2.7  Score=32.30  Aligned_cols=10  Identities=30%  Similarity=0.883  Sum_probs=9.2

Q ss_pred             ceecCCCCCC
Q 029557           47 YEYPCPFCSE   56 (191)
Q Consensus        47 ~~F~CPfC~e   56 (191)
                      +.|+||||+.
T Consensus        35 a~y~CpfCgk   44 (90)
T PRK03976         35 AKHVCPVCGR   44 (90)
T ss_pred             cCccCCCCCC
Confidence            7899999987


No 56 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=65.72  E-value=3  Score=27.06  Aligned_cols=31  Identities=32%  Similarity=0.785  Sum_probs=22.1

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCccccccccc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVT   85 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~   85 (191)
                      .+|.|+=||..|++..-        ..+...+.||.|..
T Consensus         4 Yey~C~~Cg~~fe~~~~--------~~~~~~~~CP~Cg~   34 (42)
T PF09723_consen    4 YEYRCEECGHEFEVLQS--------ISEDDPVPCPECGS   34 (42)
T ss_pred             EEEEeCCCCCEEEEEEE--------cCCCCCCcCCCCCC
Confidence            47999999987765321        12356789999977


No 57 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=65.38  E-value=2.8  Score=32.27  Aligned_cols=10  Identities=50%  Similarity=1.471  Sum_probs=9.2

Q ss_pred             ceecCCCCCC
Q 029557           47 YEYPCPFCSE   56 (191)
Q Consensus        47 ~~F~CPfC~e   56 (191)
                      +.|+||||+.
T Consensus        34 a~y~CpfCgk   43 (91)
T TIGR00280        34 AKYVCPFCGK   43 (91)
T ss_pred             cCccCCCCCC
Confidence            7899999987


No 58 
>PF12773 DZR:  Double zinc ribbon
Probab=65.28  E-value=4  Score=26.55  Aligned_cols=27  Identities=26%  Similarity=0.767  Sum_probs=18.8

Q ss_pred             cCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcc
Q 029557           50 PCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        50 ~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      .||.||..+.            ..+...++||.|.+.+.
T Consensus        14 fC~~CG~~l~------------~~~~~~~~C~~Cg~~~~   40 (50)
T PF12773_consen   14 FCPHCGTPLP------------PPDQSKKICPNCGAENP   40 (50)
T ss_pred             CChhhcCChh------------hccCCCCCCcCCcCCCc
Confidence            5777777655            44556688999977654


No 59 
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=64.67  E-value=3  Score=32.90  Aligned_cols=35  Identities=20%  Similarity=0.415  Sum_probs=20.7

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      -+|+||||+...-..-+     -.-....-+++|-+|-..
T Consensus        21 k~FtCp~Cghe~vs~ct-----vkk~~~~g~~~Cg~CGls   55 (104)
T COG4888          21 KTFTCPRCGHEKVSSCT-----VKKTVNIGTAVCGNCGLS   55 (104)
T ss_pred             ceEecCccCCeeeeEEE-----EEecCceeEEEcccCcce
Confidence            58999999984332222     111122335889999663


No 60 
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=64.32  E-value=2.1  Score=34.81  Aligned_cols=39  Identities=15%  Similarity=0.398  Sum_probs=28.4

Q ss_pred             ecCCCCCCCcCHHHHHhhhhhcCCC-CCCcccccccccCccc
Q 029557           49 YPCPFCSEDFDLVGLCCHIDEEHPV-EAKSGVCPVCVTRVTM   89 (191)
Q Consensus        49 F~CPfC~e~~D~~~L~~H~~eeH~~-e~k~vVCPICa~~~~~   89 (191)
                      =.||+||..+-.+-.  =|-.-|+. ....++||-|-....-
T Consensus        78 PgCP~CGn~~~fa~C--~CGkl~Ci~g~~~~~CPwCg~~g~~  117 (131)
T PF15616_consen   78 PGCPHCGNQYAFAVC--GCGKLFCIDGEGEVTCPWCGNEGSF  117 (131)
T ss_pred             CCCCCCcChhcEEEe--cCCCEEEeCCCCCEECCCCCCeeee
Confidence            579999995544432  58888884 5567999999876543


No 61 
>PRK12495 hypothetical protein; Provisional
Probab=64.21  E-value=4.3  Score=35.89  Aligned_cols=29  Identities=24%  Similarity=0.487  Sum_probs=22.2

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      ..|.||.||..+-            .. ...++||+|-..+.
T Consensus        41 sa~hC~~CG~PIp------------a~-pG~~~Cp~CQ~~~~   69 (226)
T PRK12495         41 TNAHCDECGDPIF------------RH-DGQEFCPTCQQPVT   69 (226)
T ss_pred             chhhcccccCccc------------CC-CCeeECCCCCCccc
Confidence            4699999999554            22 55688999988765


No 62 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=63.84  E-value=4.7  Score=28.82  Aligned_cols=31  Identities=26%  Similarity=0.667  Sum_probs=21.9

Q ss_pred             ceecCCCCCCC-cCHHHHHhhhhhcCCCCCCcccccccc
Q 029557           47 YEYPCPFCSED-FDLVGLCCHIDEEHPVEAKSGVCPVCV   84 (191)
Q Consensus        47 ~~F~CPfC~e~-~D~~~L~~H~~eeH~~e~k~vVCPICa   84 (191)
                      ..|.||-||+. +-.   |..|..    .++.-+||-|-
T Consensus        24 ~~F~CPnCG~~~I~R---C~~CRk----~~~~Y~CP~CG   55 (59)
T PRK14890         24 VKFLCPNCGEVIIYR---CEKCRK----QSNPYTCPKCG   55 (59)
T ss_pred             CEeeCCCCCCeeEee---chhHHh----cCCceECCCCC
Confidence            67999999994 544   444443    35678899884


No 63 
>COG5175 MOT2 Transcriptional repressor [Transcription]
Probab=63.70  E-value=3.8  Score=38.83  Aligned_cols=36  Identities=28%  Similarity=0.770  Sum_probs=21.5

Q ss_pred             CCCCCCCcCHHH-----------HHhhhhhcCCCCCCcccccccccCc
Q 029557           51 CPFCSEDFDLVG-----------LCCHIDEEHPVEAKSGVCPVCVTRV   87 (191)
Q Consensus        51 CPfC~e~~D~~~-----------L~~H~~eeH~~e~k~vVCPICa~~~   87 (191)
                      ||.|-|.+|+..           +|..|- .|.-+.-++.||.|..+-
T Consensus        17 cplcie~mditdknf~pc~cgy~ic~fc~-~~irq~lngrcpacrr~y   63 (480)
T COG5175          17 CPLCIEPMDITDKNFFPCPCGYQICQFCY-NNIRQNLNGRCPACRRKY   63 (480)
T ss_pred             CcccccccccccCCcccCCcccHHHHHHH-HHHHhhccCCChHhhhhc
Confidence            777777666542           333332 222334789999998753


No 64 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=63.18  E-value=2.5  Score=28.11  Aligned_cols=46  Identities=35%  Similarity=0.685  Sum_probs=29.4

Q ss_pred             ceecCCC--CCCCcCHHHHHhhhhhcCCCCCCcccccc----cccCcc-cchHhh
Q 029557           47 YEYPCPF--CSEDFDLVGLCCHIDEEHPVEAKSGVCPV----CVTRVT-MDMVDH   94 (191)
Q Consensus        47 ~~F~CPf--C~e~~D~~~L~~H~~eeH~~e~k~vVCPI----Ca~~~~-~d~v~H   94 (191)
                      ....||+  |.+.+-...|-.|+..+=+  .+.+.||.    |..++. .+|..|
T Consensus         8 ~~v~C~~~cc~~~i~r~~l~~H~~~~C~--~~~v~C~~~~~GC~~~~~~~~l~~H   60 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIPRKELDDHLENECP--KRPVPCPYSPYGCKERVPREDLEEH   60 (60)
T ss_dssp             SEEE-TT--S-BEEECCCHHHHHHTTST--TSEEE-SS----S--EEEHHHHHHC
T ss_pred             CEeeCCCCCcccceeHHHHHHHHHccCC--CCcEECCCCCCCCCCccchhHHhCC
Confidence            3578999  6667888999999985433  35789999    987765 356554


No 65 
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]
Probab=62.95  E-value=2.9  Score=39.07  Aligned_cols=57  Identities=26%  Similarity=0.549  Sum_probs=36.6

Q ss_pred             ecCCCCCCCcCHHH---HHhhhhhcCCCCCC-cccccccccCcc--------------------------cchHhhhhcc
Q 029557           49 YPCPFCSEDFDLVG---LCCHIDEEHPVEAK-SGVCPVCVTRVT--------------------------MDMVDHITTQ   98 (191)
Q Consensus        49 F~CPfC~e~~D~~~---L~~H~~eeH~~e~k-~vVCPICa~~~~--------------------------~d~v~Hl~~q   98 (191)
                      -.|--|+.-+-+-+   =|+|+-=.-|.-+. --+||.|..+|-                          +||-.||+.+
T Consensus        91 HfCd~Cd~PI~IYGRmIPCkHvFCl~CAr~~~dK~Cp~C~d~VqrIeq~~~g~iFmC~~~~GC~RTyLsqrDlqAHInhr  170 (389)
T KOG2932|consen   91 HFCDRCDFPIAIYGRMIPCKHVFCLECARSDSDKICPLCDDRVQRIEQIMMGGIFMCAAPHGCLRTYLSQRDLQAHINHR  170 (389)
T ss_pred             EeecccCCcceeeecccccchhhhhhhhhcCccccCcCcccHHHHHHHhcccceEEeecchhHHHHHhhHHHHHHHhhhh
Confidence            45666666444433   25554433332221 358999998641                          7999999999


Q ss_pred             cccchhh
Q 029557           99 HGNISNS  105 (191)
Q Consensus        99 H~~~~K~  105 (191)
                      |+.++|-
T Consensus       171 H~~~~~p  177 (389)
T KOG2932|consen  171 HGSLLQP  177 (389)
T ss_pred             hccccCC
Confidence            9988764


No 66 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=62.93  E-value=4.3  Score=27.20  Aligned_cols=25  Identities=28%  Similarity=0.598  Sum_probs=20.5

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCC
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHP   72 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~   72 (191)
                      ..+.||.|...+.. .|..|+...|.
T Consensus        30 ~~v~CPiC~~~~~~-~l~~Hl~~~H~   54 (54)
T PF05605_consen   30 KNVVCPICSSRVTD-NLIRHLNSQHR   54 (54)
T ss_pred             CCccCCCchhhhhh-HHHHHHHHhcC
Confidence            36999999996653 99999998884


No 67 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=62.29  E-value=4.6  Score=26.82  Aligned_cols=28  Identities=21%  Similarity=0.489  Sum_probs=21.4

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCc
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRV   87 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~   87 (191)
                      .|.|.-||.++++.            ....+.||-|..++
T Consensus         2 ~Y~C~~Cg~~~~~~------------~~~~irC~~CG~rI   29 (44)
T smart00659        2 IYICGECGRENEIK------------SKDVVRCRECGYRI   29 (44)
T ss_pred             EEECCCCCCEeecC------------CCCceECCCCCceE
Confidence            58899999977754            34568999997665


No 68 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=61.34  E-value=6.3  Score=27.19  Aligned_cols=38  Identities=18%  Similarity=0.378  Sum_probs=28.2

Q ss_pred             ceecCCCCCC-CcCHHHHHhhhhhcCCCCCCcccccccccCcccchHhhhh
Q 029557           47 YEYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHIT   96 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~~d~v~Hl~   96 (191)
                      .+=+||.||. .-+            ....+..+||.|-....+|+.+=++
T Consensus        27 TSq~C~~CG~~~~~------------~~~~r~~~C~~Cg~~~~rD~naA~N   65 (69)
T PF07282_consen   27 TSQTCPRCGHRNKK------------RRSGRVFTCPNCGFEMDRDVNAARN   65 (69)
T ss_pred             CccCccCccccccc------------ccccceEEcCCCCCEECcHHHHHHH
Confidence            5678999998 333            5566778999998887777776543


No 69 
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=61.12  E-value=5.5  Score=32.97  Aligned_cols=54  Identities=24%  Similarity=0.503  Sum_probs=32.4

Q ss_pred             ceecCCC----CCCCcCHHHHHhhhhhcCCCCCCcccccc----cccC-cccchHhhhhcccccch
Q 029557           47 YEYPCPF----CSEDFDLVGLCCHIDEEHPVEAKSGVCPV----CVTR-VTMDMVDHITTQHGNIS  103 (191)
Q Consensus        47 ~~F~CPf----C~e~~D~~~L~~H~~eeH~~e~k~vVCPI----Ca~~-~~~d~v~Hl~~qH~~~~  103 (191)
                      -.|||+|    |.+.+-......|-..=   .-+...||+    |.-. ...++..|+...|+...
T Consensus        13 ~~~pC~~~~~GC~~~~~~~~~~~HE~~C---~~~p~~CP~~~~~C~~~G~~~~l~~Hl~~~H~~~~   75 (198)
T PF03145_consen   13 IKFPCKNAKYGCTETFPYSEKREHEEEC---PFRPCSCPFPGSGCDWQGSYKELLDHLRDKHSWNV   75 (198)
T ss_dssp             --EE-CCGGGT---EE-GGGHHHHHHT----TTSEEE-SSSSTT---EEECCCHHHHHHHHTTTSE
T ss_pred             ceecCCCCCCCCcccccccChhhHhccC---CCcCCcCCCCCCCccccCCHHHHHHHHHHHCCCcc
Confidence            4699999    99988888888887442   345678999    7322 23699999999998754


No 70 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=60.98  E-value=2.4  Score=24.72  Aligned_cols=11  Identities=45%  Similarity=1.558  Sum_probs=9.0

Q ss_pred             eecCCCCCCCc
Q 029557           48 EYPCPFCSEDF   58 (191)
Q Consensus        48 ~F~CPfC~e~~   58 (191)
                      .|.||+|+..|
T Consensus        14 ~~~C~~C~k~F   24 (26)
T PF13465_consen   14 PYKCPYCGKSF   24 (26)
T ss_dssp             SEEESSSSEEE
T ss_pred             CCCCCCCcCee
Confidence            59999998754


No 71 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=60.80  E-value=3  Score=32.05  Aligned_cols=10  Identities=50%  Similarity=1.534  Sum_probs=8.5

Q ss_pred             ceecCCCCCC
Q 029557           47 YEYPCPFCSE   56 (191)
Q Consensus        47 ~~F~CPfC~e   56 (191)
                      ..|.||||+.
T Consensus        34 ~ky~Cp~Cgk   43 (90)
T PF01780_consen   34 AKYTCPFCGK   43 (90)
T ss_dssp             S-BEESSSSS
T ss_pred             CCCcCCCCCC
Confidence            7899999998


No 72 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=59.40  E-value=7.5  Score=32.53  Aligned_cols=32  Identities=22%  Similarity=0.402  Sum_probs=23.0

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      ..|.||-|+.-|+..+-..          ..-.||+|-...-
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~----------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME----------YGFRCPQCGEMLE  147 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh----------cCCcCCCCCCCCe
Confidence            6899999999555554332          2579999977653


No 73 
>PF13395 HNH_4:  HNH endonuclease
Probab=59.11  E-value=5.2  Score=26.98  Aligned_cols=14  Identities=29%  Similarity=1.013  Sum_probs=12.1

Q ss_pred             CCCCCCCcCHHHHH
Q 029557           51 CPFCSEDFDLVGLC   64 (191)
Q Consensus        51 CPfC~e~~D~~~L~   64 (191)
                      |||||+.++...|.
T Consensus         1 C~Y~g~~i~~~~l~   14 (54)
T PF13395_consen    1 CPYCGKPISIENLF   14 (54)
T ss_pred             CCCCCCCCChhhcc
Confidence            99999999988764


No 74 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=58.74  E-value=7.4  Score=31.80  Aligned_cols=31  Identities=19%  Similarity=0.344  Sum_probs=23.5

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRV   87 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~   87 (191)
                      ..|.||-|+.-++..+-..          ..-.||+|-...
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~~----------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAME----------LNFTCPRCGAML  138 (158)
T ss_pred             CeEECCCCCcEeeHHHHHH----------cCCcCCCCCCEe
Confidence            6799999999666655554          267999997764


No 75 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=58.47  E-value=6.1  Score=30.91  Aligned_cols=30  Identities=33%  Similarity=0.686  Sum_probs=22.7

Q ss_pred             ceecCCCCCC-CcCHHHHHhhhhhcCCCCCCcccccccccCccc
Q 029557           47 YEYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTM   89 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~~   89 (191)
                      ....||-||. =+|+             ...++|||-|.+..-.
T Consensus         8 tKR~Cp~CG~kFYDL-------------nk~PivCP~CG~~~~~   38 (108)
T PF09538_consen    8 TKRTCPSCGAKFYDL-------------NKDPIVCPKCGTEFPP   38 (108)
T ss_pred             CcccCCCCcchhccC-------------CCCCccCCCCCCccCc
Confidence            7789999999 5554             2467999999775543


No 76 
>PF04564 U-box:  U-box domain;  InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis. Molecular chaperones recognise and contribute to the refolding of misfolded or unfolded proteins, whereas the ubiquitin-proteasome system mediates the degradation of such abnormal proteins. Ubiquitin-protein ligases (E3s) determine the substrate specificity for ubiquitylation and have been classified into HECT and RING-finger families. More recently, however, U-box proteins, which contain a domain (the U box) of about 70 amino acids that is conserved from yeast to humans, have been identified as a new type of E3 []. Members of the U-box family of proteins constitute a class of ubiquitin-protein ligases (E3s) distinct from the HECT-type and RING finger-containing E3 families []. Using yeast two-hybrid technology, all mammalian U-box proteins have been reported to interact with molecular chaperones or co-chaperones, including Hsp90, Hsp70, DnaJc7, EKN1, CRN, and VCP. This suggests that the function of U box-type E3s is to mediate the degradation of unfolded or misfolded proteins in conjunction with molecular chaperones as receptors that recognise such abnormal proteins [, ]. Unlike the RING finger domain, IPR001841 from INTERPRO, that is stabilised by Zn2+ ions coordinated by the cysteines and a histidine, the U-box scaffold is probably stabilised by a system of salt-bridges and hydrogen bonds. The charged and polar residues that participate in this network of bonds are more strongly conserved in the U-box proteins than in classic RING fingers, which supports their role in maintaining the stability of the U box. Thus, the U box appears to have evolved from a RING finger domain by appropriation of a new set of residues required to stabilise its structure, concomitant with the loss of the original, metal-chelating residues [].; GO: 0004842 ubiquitin-protein ligase activity, 0016567 protein ubiquitination, 0000151 ubiquitin ligase complex; PDB: 1T1H_A 2C2L_D 2C2V_V 1WGM_A 2KR4_A 3L1Z_B 3L1X_A 2KRE_A 3M63_A 2QIZ_A ....
Probab=57.66  E-value=7.5  Score=27.55  Aligned_cols=36  Identities=17%  Similarity=0.450  Sum_probs=22.6

Q ss_pred             ceecCCCCCC------------CcCHHHHHhhhhhcCCCCCCcccccccccCcc
Q 029557           47 YEYPCPFCSE------------DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        47 ~~F~CPfC~e------------~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      ..|.||.|++            -||...+-.++..      ...+||+|...+.
T Consensus         3 ~~f~CpIt~~lM~dPVi~~~G~tyer~~I~~~l~~------~~~~~P~t~~~l~   50 (73)
T PF04564_consen    3 DEFLCPITGELMRDPVILPSGHTYERSAIERWLEQ------NGGTDPFTRQPLS   50 (73)
T ss_dssp             GGGB-TTTSSB-SSEEEETTSEEEEHHHHHHHHCT------TSSB-TTT-SB-S
T ss_pred             cccCCcCcCcHhhCceeCCcCCEEcHHHHHHHHHc------CCCCCCCCCCcCC
Confidence            3577887765            3667777777766      6789999977665


No 77 
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=57.60  E-value=5.3  Score=34.41  Aligned_cols=47  Identities=23%  Similarity=0.564  Sum_probs=29.1

Q ss_pred             ccCcceecCCCCCCCcCHHH----HHhhhhhcCCC---CCCcccccccccCccc
Q 029557           43 VKGEYEYPCPFCSEDFDLVG----LCCHIDEEHPV---EAKSGVCPVCVTRVTM   89 (191)
Q Consensus        43 ~~~~~~F~CPfC~e~~D~~~----L~~H~~eeH~~---e~k~vVCPICa~~~~~   89 (191)
                      .+....|.||.|=+.+....    =|-|+-=.-+.   =.+.++||+|..++..
T Consensus       126 ~~~~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt~  179 (187)
T KOG0320|consen  126 LRKEGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKITH  179 (187)
T ss_pred             cccccccCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCcccccch
Confidence            33346899999988666554    23443322222   1234789999987763


No 78 
>PF14616 DUF4451:  Domain of unknown function (DUF4451)
Probab=57.44  E-value=6.6  Score=31.11  Aligned_cols=27  Identities=30%  Similarity=0.478  Sum_probs=22.1

Q ss_pred             cccccccccCcc-----cchHhhhhcccccch
Q 029557           77 SGVCPVCVTRVT-----MDMVDHITTQHGNIS  103 (191)
Q Consensus        77 ~vVCPICa~~~~-----~d~v~Hl~~qH~~~~  103 (191)
                      .+.||+|....|     ..+..||+.-||-.-
T Consensus        25 eGlCp~C~~~~wl~lKnSsY~~Hl~~~HGI~s   56 (124)
T PF14616_consen   25 EGLCPYCPGGNWLKLKNSSYWYHLQFAHGISS   56 (124)
T ss_pred             eeECCCCCCCcEeeecccchhhhhhhcccccc
Confidence            789999987655     468999999998764


No 79 
>PF06957 COPI_C:  Coatomer (COPI) alpha subunit C-terminus;  InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.  This entry represents the C terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit [, ]. This domain is found along with the IPR006692 from INTERPRO domain. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat; PDB: 3MKR_B 3MV2_E 3MKQ_B 3MV3_A.
Probab=56.56  E-value=4.4  Score=38.58  Aligned_cols=36  Identities=36%  Similarity=0.999  Sum_probs=17.7

Q ss_pred             cCcceecCCCCCCCcCHHHHHhhhhhcCCCCCCccccccc-ccCcccchH
Q 029557           44 KGEYEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVC-VTRVTMDMV   92 (191)
Q Consensus        44 ~~~~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPIC-a~~~~~d~v   92 (191)
                      +|.+.-.||||+.-+            |+ +-+--+|||| ...||.+-+
T Consensus       376 ~G~~~v~CP~cgA~y------------~~-~~kG~lC~vC~l~~IG~~a~  412 (422)
T PF06957_consen  376 RGSPSVKCPYCGAKY------------HP-EYKGQLCPVCELSEIGADAS  412 (422)
T ss_dssp             TTS-EEE-TTT--EE------------EG-GGTTSB-TTTTTBBTT---S
T ss_pred             CCCCCeeCCCCCCcc------------Ch-hhCCCCCCCCcceeeCCcce
Confidence            445677899999743            22 2345699999 456775543


No 80 
>COG4311 SoxD Sarcosine oxidase delta subunit [Amino acid transport and metabolism]
Probab=55.83  E-value=5.3  Score=31.15  Aligned_cols=9  Identities=56%  Similarity=1.619  Sum_probs=7.8

Q ss_pred             eecCCCCCC
Q 029557           48 EYPCPFCSE   56 (191)
Q Consensus        48 ~F~CPfC~e   56 (191)
                      -++|||||+
T Consensus         3 LI~CP~Cg~   11 (97)
T COG4311           3 LIPCPYCGE   11 (97)
T ss_pred             eecCCCCCC
Confidence            478999998


No 81 
>PRK12496 hypothetical protein; Provisional
Probab=53.59  E-value=8.5  Score=31.74  Aligned_cols=27  Identities=22%  Similarity=0.584  Sum_probs=19.2

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCc
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRV   87 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~   87 (191)
                      .|.|+-|+..|+.             ....-+||||-..+
T Consensus       127 ~~~C~gC~~~~~~-------------~~~~~~C~~CG~~~  153 (164)
T PRK12496        127 RKVCKGCKKKYPE-------------DYPDDVCEICGSPV  153 (164)
T ss_pred             eEECCCCCccccC-------------CCCCCcCCCCCChh
Confidence            5999999987753             12235899996554


No 82 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=52.62  E-value=9.5  Score=32.10  Aligned_cols=25  Identities=32%  Similarity=0.848  Sum_probs=17.6

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      .+.||.||-             .|.. -.+.+||||-+.
T Consensus       134 ~~vC~vCGy-------------~~~g-e~P~~CPiCga~  158 (166)
T COG1592         134 VWVCPVCGY-------------THEG-EAPEVCPICGAP  158 (166)
T ss_pred             EEEcCCCCC-------------cccC-CCCCcCCCCCCh
Confidence            689999974             1222 446899999753


No 83 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=52.61  E-value=8.4  Score=23.01  Aligned_cols=8  Identities=38%  Similarity=1.244  Sum_probs=3.9

Q ss_pred             CCCCCCCc
Q 029557           51 CPFCSEDF   58 (191)
Q Consensus        51 CPfC~e~~   58 (191)
                      ||-|+..+
T Consensus         3 CP~C~~~V   10 (26)
T PF10571_consen    3 CPECGAEV   10 (26)
T ss_pred             CCCCcCCc
Confidence            55555443


No 84 
>KOG0402 consensus 60S ribosomal protein L37 [Translation, ribosomal structure and biogenesis]
Probab=52.17  E-value=4.5  Score=31.13  Aligned_cols=11  Identities=36%  Similarity=1.189  Sum_probs=9.8

Q ss_pred             cceecCCCCCC
Q 029557           46 EYEYPCPFCSE   56 (191)
Q Consensus        46 ~~~F~CPfC~e   56 (191)
                      |+.|.|+|||+
T Consensus        34 haky~CsfCGK   44 (92)
T KOG0402|consen   34 HAKYTCSFCGK   44 (92)
T ss_pred             hhhhhhhhcch
Confidence            37899999998


No 85 
>PRK00420 hypothetical protein; Validated
Probab=52.16  E-value=9.9  Score=30.13  Aligned_cols=28  Identities=25%  Similarity=0.431  Sum_probs=18.9

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCc
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRV   87 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~   87 (191)
                      .-.||.||..+-.            .....++||+|...+
T Consensus        23 ~~~CP~Cg~pLf~------------lk~g~~~Cp~Cg~~~   50 (112)
T PRK00420         23 SKHCPVCGLPLFE------------LKDGEVVCPVHGKVY   50 (112)
T ss_pred             cCCCCCCCCccee------------cCCCceECCCCCCee
Confidence            4689999974311            124568999998754


No 86 
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=50.96  E-value=7.5  Score=30.34  Aligned_cols=38  Identities=24%  Similarity=0.467  Sum_probs=21.8

Q ss_pred             ecCCCCCCCcCH---HHHHhhhhhcCCCCCCcccccccccCccc
Q 029557           49 YPCPFCSEDFDL---VGLCCHIDEEHPVEAKSGVCPVCVTRVTM   89 (191)
Q Consensus        49 F~CPfC~e~~D~---~~L~~H~~eeH~~e~k~vVCPICa~~~~~   89 (191)
                      -.|||||....+   ..+.-|-.+.+   +-.-+|+-|-+.||.
T Consensus         3 ~~CpYCg~~~~l~~~~~iYg~~~~~~---~~~y~C~~C~AyVG~   43 (102)
T PF11672_consen    3 IICPYCGGPAELVDGSEIYGHRYDDG---PYLYVCTPCDAYVGC   43 (102)
T ss_pred             cccCCCCCeeEEcccchhcCccCCCC---ceeEECCCCCceeee
Confidence            469999993322   22222222211   112689999999884


No 87 
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=50.96  E-value=5.1  Score=34.09  Aligned_cols=21  Identities=19%  Similarity=0.453  Sum_probs=0.0

Q ss_pred             cccccccccCcc-cchHhhhhc
Q 029557           77 SGVCPVCVTRVT-MDMVDHITT   97 (191)
Q Consensus        77 ~vVCPICa~~~~-~d~v~Hl~~   97 (191)
                      .++||||-.+|- ..|-.||++
T Consensus       168 ~~~cPitGe~IP~~e~~eHmRi  189 (229)
T PF12230_consen  168 MIICPITGEMIPADEMDEHMRI  189 (229)
T ss_dssp             ----------------------
T ss_pred             cccccccccccccccccccccc
Confidence            379999999865 689999975


No 88 
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=50.53  E-value=8.1  Score=24.48  Aligned_cols=20  Identities=20%  Similarity=0.469  Sum_probs=8.2

Q ss_pred             eecCCCCCCCcCHHHHHhhh
Q 029557           48 EYPCPFCSEDFDLVGLCCHI   67 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~   67 (191)
                      +|.||-|+..+-..-+..|+
T Consensus         4 ~~~C~nC~R~v~a~RfA~HL   23 (33)
T PF08209_consen    4 YVECPNCGRPVAASRFAPHL   23 (33)
T ss_dssp             EEE-TTTSSEEEGGGHHHHH
T ss_pred             eEECCCCcCCcchhhhHHHH
Confidence            34444444444444444443


No 89 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=50.47  E-value=10  Score=31.98  Aligned_cols=35  Identities=20%  Similarity=0.441  Sum_probs=27.3

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcccchHhhhhc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITT   97 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~~d~v~Hl~~   97 (191)
                      ..=.||.||.                ...+...||.|-...-+|..+=+++
T Consensus       308 tS~~C~~cg~----------------~~~r~~~C~~cg~~~~rD~naa~Ni  342 (364)
T COG0675         308 TSKTCPCCGH----------------LSGRLFKCPRCGFVHDRDVNAALNI  342 (364)
T ss_pred             CcccccccCC----------------ccceeEECCCCCCeehhhHHHHHHH
Confidence            4477999998                3467789999988877888777653


No 90 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=50.02  E-value=8.8  Score=26.54  Aligned_cols=9  Identities=44%  Similarity=1.652  Sum_probs=8.0

Q ss_pred             eecCCCCCC
Q 029557           48 EYPCPFCSE   56 (191)
Q Consensus        48 ~F~CPfC~e   56 (191)
                      .|.||+|+.
T Consensus        44 ~y~C~~Cg~   52 (54)
T PF10058_consen   44 QYRCPYCGA   52 (54)
T ss_pred             EEEcCCCCC
Confidence            599999986


No 91 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=49.79  E-value=11  Score=22.06  Aligned_cols=10  Identities=30%  Similarity=0.919  Sum_probs=6.2

Q ss_pred             ecCCCCCCCc
Q 029557           49 YPCPFCSEDF   58 (191)
Q Consensus        49 F~CPfC~e~~   58 (191)
                      -.||.||..+
T Consensus         3 ~~Cp~Cg~~~   12 (26)
T PF13248_consen    3 MFCPNCGAEI   12 (26)
T ss_pred             CCCcccCCcC
Confidence            3577777643


No 92 
>PRK03922 hypothetical protein; Provisional
Probab=48.40  E-value=8.8  Score=30.70  Aligned_cols=14  Identities=43%  Similarity=0.786  Sum_probs=11.4

Q ss_pred             eecCCCCCCCcCHH
Q 029557           48 EYPCPFCSEDFDLV   61 (191)
Q Consensus        48 ~F~CPfC~e~~D~~   61 (191)
                      .-.||+||++|+-.
T Consensus        49 ~~~cP~cge~~~~a   62 (113)
T PRK03922         49 LTICPKCGEPFDSA   62 (113)
T ss_pred             cccCCCCCCcCCcE
Confidence            56899999998743


No 93 
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=47.68  E-value=12  Score=37.82  Aligned_cols=27  Identities=30%  Similarity=0.415  Sum_probs=24.3

Q ss_pred             eecCCCCCC-CcCHHHHHhhhhhcCCCC
Q 029557           48 EYPCPFCSE-DFDLVGLCCHIDEEHPVE   74 (191)
Q Consensus        48 ~F~CPfC~e-~~D~~~L~~H~~eeH~~e   74 (191)
                      ---|+||-+ -||..+|..|+..+|.+.
T Consensus       182 hp~C~~C~~~fld~~el~rH~~~~h~~c  209 (669)
T KOG2231|consen  182 HPLCKFCHERFLDDDELYRHLRFDHEFC  209 (669)
T ss_pred             CccchhhhhhhccHHHHHHhhccceehe
Confidence            467999999 999999999999999873


No 94 
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional
Probab=47.52  E-value=5.6  Score=34.17  Aligned_cols=32  Identities=28%  Similarity=0.616  Sum_probs=20.0

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhcCCCC-CCccc
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEEHPVE-AKSGV   79 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~eeH~~e-~k~vV   79 (191)
                      .|.||.|+..+.+..=-=+|...|.+| ++.+.
T Consensus         2 ~~~CP~C~~~l~~~~~~~~C~~~h~fd~a~~Gy   34 (272)
T PRK11088          2 SYQCPLCHQPLTLEENSWICPQNHQFDCAKEGY   34 (272)
T ss_pred             cccCCCCCcchhcCCCEEEcCCCCCCccccCce
Confidence            389999999764332223466778874 34443


No 95 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=47.19  E-value=16  Score=23.07  Aligned_cols=29  Identities=31%  Similarity=0.764  Sum_probs=18.4

Q ss_pred             ecCCCCCCCcCHH--HHHhhhhhcCCCCCCccccccccc
Q 029557           49 YPCPFCSEDFDLV--GLCCHIDEEHPVEAKSGVCPVCVT   85 (191)
Q Consensus        49 F~CPfC~e~~D~~--~L~~H~~eeH~~e~k~vVCPICa~   85 (191)
                      ..||-|+..|.+.  .|        +...+.|.||-|..
T Consensus         3 i~CP~C~~~f~v~~~~l--------~~~~~~vrC~~C~~   33 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDKL--------PAGGRKVRCPKCGH   33 (37)
T ss_pred             EECCCCCceEEcCHHHc--------ccCCcEEECCCCCc
Confidence            5788888855443  22        22456788888854


No 96 
>PF04475 DUF555:  Protein of unknown function (DUF555);  InterPro: IPR007564 This is a family of uncharacterised, hypothetical archaeal proteins.
Probab=46.98  E-value=9.4  Score=30.03  Aligned_cols=14  Identities=36%  Similarity=0.878  Sum_probs=11.4

Q ss_pred             eecCCCCCCCcCHH
Q 029557           48 EYPCPFCSEDFDLV   61 (191)
Q Consensus        48 ~F~CPfC~e~~D~~   61 (191)
                      .-.||+|+++|+-.
T Consensus        47 ~~~cP~Cge~~~~a   60 (102)
T PF04475_consen   47 DTICPKCGEELDSA   60 (102)
T ss_pred             cccCCCCCCccCce
Confidence            56899999988743


No 97 
>PF08996 zf-DNA_Pol:  DNA Polymerase alpha zinc finger;  InterPro: IPR015088 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNA Polymerase alpha zinc finger domain adopts an alpha-helix-like structure, followed by three turns, all of which involve proline. The resulting motif is a helix-turn-helix motif, in contrast to other zinc finger domains, which show anti-parallel sheet and helix conformation. Zinc binding occurs due to the presence of four cysteine residues positioned to bind the metal centre in a tetrahedral coordination geometry. The function of this domain is uncertain: it has been proposed that the zinc finger motif may be an essential part of the DNA binding domain [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0001882 nucleoside binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3FLO_D 1N5G_A 1K0P_A 1K18_A.
Probab=46.03  E-value=3.1  Score=34.72  Aligned_cols=39  Identities=26%  Similarity=0.698  Sum_probs=19.4

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcc
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      .|+||.|+..+...++..  .+.-........||-|.....
T Consensus        18 ~~~C~~C~~~~~f~g~~~--~~~~~~~~~~~~C~~C~~~~~   56 (188)
T PF08996_consen   18 KLTCPSCGTEFEFPGVFE--EDGDDVSPSGLQCPNCSTPLS   56 (188)
T ss_dssp             EEE-TTT--EEEE-SSS----SSEEEETTEEEETTT--B--
T ss_pred             EeECCCCCCCcccccccc--CCccccccCcCcCCCCCCcCC
Confidence            699999999777777544  111112344578999988544


No 98 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=45.87  E-value=7.4  Score=30.25  Aligned_cols=27  Identities=30%  Similarity=0.386  Sum_probs=20.4

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      ..+.|+-|+..+.....             ...||-|...
T Consensus        69 ~~~~C~~Cg~~~~~~~~-------------~~~CP~Cgs~   95 (115)
T TIGR00100        69 VECECEDCSEEVSPEID-------------LYRCPKCHGI   95 (115)
T ss_pred             cEEEcccCCCEEecCCc-------------CccCcCCcCC
Confidence            57999999987766532             4679999763


No 99 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=45.63  E-value=18  Score=21.42  Aligned_cols=22  Identities=18%  Similarity=0.608  Sum_probs=14.9

Q ss_pred             eecCCCCCCCcC-HHHHHhhhhh
Q 029557           48 EYPCPFCSEDFD-LVGLCCHIDE   69 (191)
Q Consensus        48 ~F~CPfC~e~~D-~~~L~~H~~e   69 (191)
                      .|.|.+|+..|. ...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            477888888555 6667777653


No 100
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=45.19  E-value=13  Score=30.01  Aligned_cols=40  Identities=33%  Similarity=0.670  Sum_probs=28.9

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcccchH
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMV   92 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~~d~v   92 (191)
                      .+.|.-|+..++...+..........     .||.|...+-.|.+
T Consensus       105 ~~~C~~C~~~~~~~~~~~~~~~~~~~-----~C~~C~~~lrp~vv  144 (178)
T PF02146_consen  105 RLRCSKCGKEYDREDIVDSIDEEEPP-----RCPKCGGLLRPDVV  144 (178)
T ss_dssp             EEEETTTSBEEEGHHHHHHHHTTSSC-----BCTTTSCBEEEEE-
T ss_pred             eeeecCCCccccchhhcccccccccc-----cccccCccCCCCee
Confidence            68999999988888777665544322     99999886554444


No 101
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=44.31  E-value=14  Score=25.86  Aligned_cols=25  Identities=32%  Similarity=0.773  Sum_probs=17.5

Q ss_pred             ecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           49 YPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        49 F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      -.||.|++.|..             +.-.||||.|.+.
T Consensus         6 ~~C~~Cg~~~~~-------------~dDiVvCp~Cgap   30 (54)
T PF14446_consen    6 CKCPVCGKKFKD-------------GDDIVVCPECGAP   30 (54)
T ss_pred             ccChhhCCcccC-------------CCCEEECCCCCCc
Confidence            578999886621             2345899999774


No 102
>smart00507 HNHc HNH nucleases.
Probab=43.83  E-value=5.1  Score=24.68  Aligned_cols=21  Identities=19%  Similarity=0.175  Sum_probs=13.5

Q ss_pred             ecCCCCCCCcCHHHHHhhhhh
Q 029557           49 YPCPFCSEDFDLVGLCCHIDE   69 (191)
Q Consensus        49 F~CPfC~e~~D~~~L~~H~~e   69 (191)
                      +.|+||+..++..--+.|+..
T Consensus        11 ~~C~~C~~~~~~~~~v~Hi~p   31 (52)
T smart00507       11 GVCAYCGKPASEGLEVDHIIP   31 (52)
T ss_pred             CCCcCCcCCCCCCeEEEecCC
Confidence            799999996654233444443


No 103
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=43.79  E-value=15  Score=31.51  Aligned_cols=35  Identities=26%  Similarity=0.553  Sum_probs=21.3

Q ss_pred             CCCCCC--CcCHHHHHhhhhhcCCC------CCCccccccccc
Q 029557           51 CPFCSE--DFDLVGLCCHIDEEHPV------EAKSGVCPVCVT   85 (191)
Q Consensus        51 CPfC~e--~~D~~~L~~H~~eeH~~------e~k~vVCPICa~   85 (191)
                      ||.||.  +-.+.+||.=|--+...      .....+||.|-+
T Consensus         1 C~~CG~~~~~~~~~lC~~C~~~~~~i~ei~~~i~v~~C~~Cg~   43 (236)
T PF04981_consen    1 CPRCGREIEPLIDGLCPDCYLKRFDIIEIPDRIEVTICPKCGR   43 (236)
T ss_pred             CCCCCCCCCCcccccChHHhcccCCeeecCCccCceECCCCCC
Confidence            888887  33345677666544432      224577888865


No 104
>PF14279 HNH_5:  HNH endonuclease
Probab=43.65  E-value=5.5  Score=28.87  Aligned_cols=40  Identities=20%  Similarity=0.556  Sum_probs=24.6

Q ss_pred             CCCCCCCcCHHHHHhhhhhcCCC--------CCCcccccccccCcccchHhhh
Q 029557           51 CPFCSEDFDLVGLCCHIDEEHPV--------EAKSGVCPVCVTRVTMDMVDHI   95 (191)
Q Consensus        51 CPfC~e~~D~~~L~~H~~eeH~~--------e~k~vVCPICa~~~~~d~v~Hl   95 (191)
                      |.||.++++....-    .||-.        ..+. ||--|-...+...-+++
T Consensus         1 Ci~C~~~~~~~~~s----~EHIIP~sLGG~~~~~~-vC~~CN~~~g~~vD~~l   48 (71)
T PF14279_consen    1 CIYCNKEKSESNFS----EEHIIPESLGGKLKINN-VCDKCNNKFGSKVDAEL   48 (71)
T ss_pred             CccCCCCCCccCCC----ccccCchhcCCcccccc-hhHHHhHHHhHHHHHHH
Confidence            89999977654322    45544        2233 88888887774444433


No 105
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=42.67  E-value=12  Score=34.46  Aligned_cols=38  Identities=34%  Similarity=0.552  Sum_probs=24.0

Q ss_pred             eecCCCCCC--Cc--CHH--------HHHhhhhhcCCCCCCcccccccccC
Q 029557           48 EYPCPFCSE--DF--DLV--------GLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        48 ~F~CPfC~e--~~--D~~--------~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      .+.||.|..  .+  +..        .+|..|.+..-.. ....||+|...
T Consensus         3 ~~~CP~Ck~~~y~np~~kl~i~~CGH~~C~sCv~~l~~~-~~~~CP~C~~~   52 (309)
T TIGR00570         3 DQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVR-GSGSCPECDTP   52 (309)
T ss_pred             CCCCCcCCCCCccCcccccccCCCCCcccHHHHHHHhcC-CCCCCCCCCCc
Confidence            478999988  22  211        2466676666433 44699999764


No 106
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=42.03  E-value=18  Score=20.75  Aligned_cols=20  Identities=20%  Similarity=0.313  Sum_probs=13.3

Q ss_pred             ecCCCCCC-CcCHHHHHhhhh
Q 029557           49 YPCPFCSE-DFDLVGLCCHID   68 (191)
Q Consensus        49 F~CPfC~e-~~D~~~L~~H~~   68 (191)
                      |.|+.|+. =-+...|..|+.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            67777777 446666666664


No 107
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=41.75  E-value=11  Score=29.91  Aligned_cols=25  Identities=28%  Similarity=0.984  Sum_probs=16.3

Q ss_pred             cCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           50 PCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        50 ~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      +||-|+.++.-.            +....|||-|+.-
T Consensus         4 ~CP~C~seytY~------------dg~~~iCpeC~~E   28 (109)
T TIGR00686         4 PCPKCNSEYTYH------------DGTQLICPSCLYE   28 (109)
T ss_pred             cCCcCCCcceEe------------cCCeeECcccccc
Confidence            588877654321            4556889999764


No 108
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=40.98  E-value=16  Score=29.79  Aligned_cols=28  Identities=21%  Similarity=0.381  Sum_probs=21.6

Q ss_pred             ceecCCCCCC-CcCHHHHHhhhhhcCCCCCCcccccccccCc
Q 029557           47 YEYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRV   87 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~   87 (191)
                      ....||-||. =+|+             ...++|||-|-...
T Consensus         8 tKr~Cp~cg~kFYDL-------------nk~p~vcP~cg~~~   36 (129)
T TIGR02300         8 TKRICPNTGSKFYDL-------------NRRPAVSPYTGEQF   36 (129)
T ss_pred             ccccCCCcCcccccc-------------CCCCccCCCcCCcc
Confidence            7789999999 5553             34679999997654


No 109
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=40.91  E-value=7.8  Score=35.49  Aligned_cols=41  Identities=29%  Similarity=0.511  Sum_probs=26.1

Q ss_pred             ceecCCCCCC--CcCHHHH-HhhhhhcCCCCCCc-----ccccccccCc
Q 029557           47 YEYPCPFCSE--DFDLVGL-CCHIDEEHPVEAKS-----GVCPVCVTRV   87 (191)
Q Consensus        47 ~~F~CPfC~e--~~D~~~L-~~H~~eeH~~e~k~-----vVCPICa~~~   87 (191)
                      .+-.||+||+  -+--... |.|+-=+-|.-++.     -.||-|.+.+
T Consensus       238 ~~~~C~~Cg~~PtiP~~~~~C~HiyCY~Ci~ts~~~~asf~Cp~Cg~~~  286 (298)
T KOG2879|consen  238 SDTECPVCGEPPTIPHVIGKCGHIYCYYCIATSRLWDASFTCPLCGENV  286 (298)
T ss_pred             CCceeeccCCCCCCCeeeccccceeehhhhhhhhcchhhcccCccCCCC
Confidence            4578999999  4444444 78865555544433     3788887654


No 110
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=40.87  E-value=17  Score=34.62  Aligned_cols=15  Identities=20%  Similarity=0.691  Sum_probs=10.2

Q ss_pred             ceecCCCCCCCcCHH
Q 029557           47 YEYPCPFCSEDFDLV   61 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~   61 (191)
                      .+|.||||-.+-+..
T Consensus       373 ~sfKCPYCP~e~~~~  387 (394)
T KOG2817|consen  373 QSFKCPYCPVEQLAS  387 (394)
T ss_pred             eeeeCCCCCcccCHH
Confidence            468888887755443


No 111
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=40.42  E-value=9  Score=27.64  Aligned_cols=27  Identities=26%  Similarity=0.481  Sum_probs=19.7

Q ss_pred             ccccccccC--cccchHhhhhcccccchh
Q 029557           78 GVCPVCVTR--VTMDMVDHITTQHGNISN  104 (191)
Q Consensus        78 vVCPICa~~--~~~d~v~Hl~~qH~~~~K  104 (191)
                      ..||-|.+.  -..|.++|.+-.|+++|.
T Consensus        18 lrCPRC~~~FR~~K~Y~RHVNKaH~~~~~   46 (65)
T COG4049          18 LRCPRCGMVFRRRKDYIRHVNKAHGWLFG   46 (65)
T ss_pred             eeCCchhHHHHHhHHHHHHhhHHhhhhhc
Confidence            456666552  346899999999999873


No 112
>PRK11595 DNA utilization protein GntX; Provisional
Probab=40.14  E-value=15  Score=31.22  Aligned_cols=33  Identities=24%  Similarity=0.565  Sum_probs=18.6

Q ss_pred             cCCCCCCCcCH--HHHHhhhhhcCCCCCCcccccccc
Q 029557           50 PCPFCSEDFDL--VGLCCHIDEEHPVEAKSGVCPVCV   84 (191)
Q Consensus        50 ~CPfC~e~~D~--~~L~~H~~eeH~~e~k~vVCPICa   84 (191)
                      .|+.|++.+..  ..||.+|.+.=..-  ...||.|.
T Consensus         7 ~C~~C~~~~~~~~~~lC~~C~~~l~~~--~~~C~~Cg   41 (227)
T PRK11595          7 LCWLCRMPLALSHWGICSVCSRALRTL--KTCCPQCG   41 (227)
T ss_pred             cCccCCCccCCCCCcccHHHHhhCCcc--cCcCccCC
Confidence            48888874432  35788886552221  23566654


No 113
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=40.00  E-value=9.8  Score=30.27  Aligned_cols=36  Identities=36%  Similarity=0.579  Sum_probs=22.6

Q ss_pred             ceecCCCCCCCcCHH-HH-Hhh-----hhhcCCCCCCcccccccc
Q 029557           47 YEYPCPFCSEDFDLV-GL-CCH-----IDEEHPVEAKSGVCPVCV   84 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~-~L-~~H-----~~eeH~~e~k~vVCPICa   84 (191)
                      ..+.||+|.+.|... -| |-|     |......  ....||+|.
T Consensus        12 ~~~~C~iC~~~~~~p~~l~C~H~~c~~C~~~~~~--~~~~Cp~cr   54 (386)
T KOG2177|consen   12 EELTCPICLEYFREPVLLPCGHNFCRACLTRSWE--GPLSCPVCR   54 (386)
T ss_pred             ccccChhhHHHhhcCccccccchHhHHHHHHhcC--CCcCCcccC
Confidence            468999999966655 22 223     3322222  348999998


No 114
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=39.87  E-value=14  Score=26.06  Aligned_cols=10  Identities=30%  Similarity=0.939  Sum_probs=8.8

Q ss_pred             ceecCCCCCC
Q 029557           47 YEYPCPFCSE   56 (191)
Q Consensus        47 ~~F~CPfC~e   56 (191)
                      ..|+||.||.
T Consensus        13 v~~~Cp~cGi   22 (55)
T PF13824_consen   13 VNFECPDCGI   22 (55)
T ss_pred             cCCcCCCCCC
Confidence            7899999986


No 115
>PF14353 CpXC:  CpXC protein
Probab=39.47  E-value=15  Score=28.28  Aligned_cols=28  Identities=29%  Similarity=0.413  Sum_probs=18.7

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhcCCCCCCccc
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGV   79 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vV   79 (191)
                      .|+||.||..+-+    .+--.+|-.+.+.++
T Consensus        38 ~~~CP~Cg~~~~~----~~p~lY~D~~~~~~i   65 (128)
T PF14353_consen   38 SFTCPSCGHKFRL----EYPLLYHDPEKKFMI   65 (128)
T ss_pred             EEECCCCCCceec----CCCEEEEcCCCCEEE
Confidence            7999999996543    445556665655543


No 116
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=38.94  E-value=21  Score=26.81  Aligned_cols=32  Identities=19%  Similarity=0.371  Sum_probs=25.8

Q ss_pred             CCCCCcccccccccCcc-cchHhhhhcccccch
Q 029557           72 PVEAKSGVCPVCVTRVT-MDMVDHITTQHGNIS  103 (191)
Q Consensus        72 ~~e~k~vVCPICa~~~~-~d~v~Hl~~qH~~~~  103 (191)
                      ..+.+.+||-.|-.-|+ ..+.+||..+|..+.
T Consensus         6 ~~~~~vlIC~~C~~av~~~~v~~HL~~~H~~~~   38 (109)
T PF12013_consen    6 NPEYRVLICRQCQYAVQPSEVESHLRKRHHILK   38 (109)
T ss_pred             cCcCCEEEeCCCCcccCchHHHHHHHHhccccc
Confidence            34678899999987665 799999998888763


No 117
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=38.53  E-value=16  Score=22.45  Aligned_cols=9  Identities=44%  Similarity=1.095  Sum_probs=4.7

Q ss_pred             CCccccccc
Q 029557           75 AKSGVCPVC   83 (191)
Q Consensus        75 ~k~vVCPIC   83 (191)
                      ...+.||+|
T Consensus        33 ~~~~~CP~C   41 (41)
T PF00097_consen   33 SGSVKCPLC   41 (41)
T ss_dssp             TSSSBTTTT
T ss_pred             cCCccCCcC
Confidence            344456665


No 118
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=37.85  E-value=13  Score=28.82  Aligned_cols=27  Identities=22%  Similarity=0.438  Sum_probs=19.1

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      ..+.|+-|+..|.+..             ....||-|-..
T Consensus        69 ~~~~C~~Cg~~~~~~~-------------~~~~CP~Cgs~   95 (113)
T PRK12380         69 AQAWCWDCSQVVEIHQ-------------HDAQCPHCHGE   95 (113)
T ss_pred             cEEEcccCCCEEecCC-------------cCccCcCCCCC
Confidence            5699999998665533             33469999753


No 119
>COG1499 NMD3 NMD protein affecting ribosome stability and mRNA decay [Translation, ribosomal structure and biogenesis]
Probab=37.28  E-value=17  Score=33.92  Aligned_cols=39  Identities=31%  Similarity=0.598  Sum_probs=28.7

Q ss_pred             ceecCCCCCCCcC--HHHHHhhhhhc-CCC-----CCCccccccccc
Q 029557           47 YEYPCPFCSEDFD--LVGLCCHIDEE-HPV-----EAKSGVCPVCVT   85 (191)
Q Consensus        47 ~~F~CPfC~e~~D--~~~L~~H~~ee-H~~-----e~k~vVCPICa~   85 (191)
                      .+-.||.||...|  +.+||.=|--+ |+.     +.+..+|+-|-+
T Consensus         5 ~~~~C~~CGr~~~~~~~~lC~dC~~~~~~~~~ip~~~~v~~C~~Cga   51 (355)
T COG1499           5 STILCVRCGRSVDPLIDGLCGDCYVETTPLIEIPDEVNVEVCRHCGA   51 (355)
T ss_pred             cccEeccCCCcCchhhccccHHHHhccCccccCCCceEEEECCcCCC
Confidence            5678999999887  88888877665 544     233477888864


No 120
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=36.96  E-value=15  Score=29.35  Aligned_cols=40  Identities=23%  Similarity=0.426  Sum_probs=22.0

Q ss_pred             ceecCCCCCCCcCHHHHHhhhh-----hcCCCC---CCcccccccccC
Q 029557           47 YEYPCPFCSEDFDLVGLCCHID-----EEHPVE---AKSGVCPVCVTR   86 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~-----eeH~~e---~k~vVCPICa~~   86 (191)
                      ..+.|+-||..+...+--.++.     .-|-..   .....||.|-..
T Consensus        69 ~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CP~Cgs~  116 (135)
T PRK03824         69 AVLKCRNCGNEWSLKEVKESLDEEIREAIHFIPEVVHAFLKCPKCGSR  116 (135)
T ss_pred             eEEECCCCCCEEecccccccccccccccccccccccccCcCCcCCCCC
Confidence            5799999998665542111111     112111   244679999754


No 121
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=36.65  E-value=12  Score=25.15  Aligned_cols=14  Identities=29%  Similarity=0.667  Sum_probs=7.3

Q ss_pred             cCCCCCCCcCHHHH
Q 029557           50 PCPFCSEDFDLVGL   63 (191)
Q Consensus        50 ~CPfC~e~~D~~~L   63 (191)
                      .||.|+.+||...-
T Consensus        22 ~CPlC~r~l~~e~~   35 (54)
T PF04423_consen   22 CCPLCGRPLDEEHR   35 (54)
T ss_dssp             E-TTT--EE-HHHH
T ss_pred             cCCCCCCCCCHHHH
Confidence            89999998876543


No 122
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=35.75  E-value=16  Score=23.70  Aligned_cols=27  Identities=26%  Similarity=0.429  Sum_probs=14.9

Q ss_pred             cCCCCCCCcCHHHHHhhhhhcCCCCCCccccccccc
Q 029557           50 PCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVT   85 (191)
Q Consensus        50 ~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~   85 (191)
                      .||-||.-+-..+      .+   +....+||.|..
T Consensus         2 FCp~Cg~~l~~~~------~~---~~~~~vC~~Cg~   28 (52)
T smart00661        2 FCPKCGNMLIPKE------GK---EKRRFVCRKCGY   28 (52)
T ss_pred             CCCCCCCcccccc------CC---CCCEEECCcCCC
Confidence            4888887332221      11   123678999964


No 123
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=35.63  E-value=15  Score=32.75  Aligned_cols=61  Identities=23%  Similarity=0.364  Sum_probs=0.0

Q ss_pred             ecCCCCCC-CcCHHHHHhhhhhcCCCCCCcccccccccCccc--chHhhhh----cccccchhhhhhhccc
Q 029557           49 YPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTM--DMVDHIT----TQHGNISNSWHKLKLH  112 (191)
Q Consensus        49 F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~~--d~v~Hl~----~qH~~~~K~~rrrk~~  112 (191)
                      +.|-|||+ =.|.-.|..|....-  .-++-.|-+|..-.+.  .+-.|+.    .+|.+-+| +||-|+.
T Consensus       146 ~lct~cgkgfndtfdlkrh~rtht--gvrpykc~~c~kaftqrcsleshl~kvhgv~~~yayk-err~kl~  213 (267)
T KOG3576|consen  146 HLCTFCGKGFNDTFDLKRHTRTHT--GVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYK-ERRAKLY  213 (267)
T ss_pred             HHHhhccCcccchhhhhhhhcccc--CccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHH-Hhhhhee


No 124
>PRK05477 gatB aspartyl/glutamyl-tRNA amidotransferase subunit B; Validated
Probab=35.32  E-value=18  Score=34.97  Aligned_cols=22  Identities=27%  Similarity=0.607  Sum_probs=16.3

Q ss_pred             hhhcCCCCCCcccccccccCcc
Q 029557           67 IDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        67 ~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      |..+.-.+++.-|||||...||
T Consensus        27 c~~~~~~~PNt~vcpv~lg~PG   48 (474)
T PRK05477         27 CSTDFGAEPNTNVCPVCLGLPG   48 (474)
T ss_pred             CCcccCCCCCCCcCccccCCCC
Confidence            3333444678899999999987


No 125
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=35.06  E-value=9.2  Score=29.54  Aligned_cols=27  Identities=22%  Similarity=0.475  Sum_probs=17.7

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      ..+.|+-|+..|++....             ..||-|-..
T Consensus        69 ~~~~C~~Cg~~~~~~~~~-------------~~CP~Cgs~   95 (113)
T PF01155_consen   69 ARARCRDCGHEFEPDEFD-------------FSCPRCGSP   95 (113)
T ss_dssp             -EEEETTTS-EEECHHCC-------------HH-SSSSSS
T ss_pred             CcEECCCCCCEEecCCCC-------------CCCcCCcCC
Confidence            579999999987766543             239999764


No 126
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=34.88  E-value=19  Score=33.89  Aligned_cols=11  Identities=36%  Similarity=1.253  Sum_probs=9.3

Q ss_pred             ceecCCCCCCC
Q 029557           47 YEYPCPFCSED   57 (191)
Q Consensus        47 ~~F~CPfC~e~   57 (191)
                      .+|.||||-++
T Consensus       375 ~~FKCPYCP~~  385 (396)
T COG5109         375 LSFKCPYCPEM  385 (396)
T ss_pred             EEeeCCCCCcc
Confidence            57999999883


No 127
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=34.74  E-value=21  Score=33.77  Aligned_cols=40  Identities=33%  Similarity=0.600  Sum_probs=31.8

Q ss_pred             eecCCC--CCC-CcCHHHHHhhhhhcCCC-----------------CCCcccccccccCc
Q 029557           48 EYPCPF--CSE-DFDLVGLCCHIDEEHPV-----------------EAKSGVCPVCVTRV   87 (191)
Q Consensus        48 ~F~CPf--C~e-~~D~~~L~~H~~eeH~~-----------------e~k~vVCPICa~~~   87 (191)
                      -|.||.  |.+ .-.+-+|.-|...-|+.                 +.|+-+|+||..+-
T Consensus       349 pykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRY  408 (423)
T COG5189         349 PYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRY  408 (423)
T ss_pred             eecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhh
Confidence            499997  777 77889999999888832                 33567899998875


No 128
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=34.64  E-value=16  Score=35.35  Aligned_cols=48  Identities=17%  Similarity=0.279  Sum_probs=34.1

Q ss_pred             CcCHHHHHhhhhhcCCCCC-----------------CcccccccccCcc--cchHhhhhcccccchh
Q 029557           57 DFDLVGLCCHIDEEHPVEA-----------------KSGVCPVCVTRVT--MDMVDHITTQHGNISN  104 (191)
Q Consensus        57 ~~D~~~L~~H~~eeH~~e~-----------------k~vVCPICa~~~~--~d~v~Hl~~qH~~~~K  104 (191)
                      .+++..|..|+...|..++                 +.-+||+|..+-.  .++..|+...|-.-++
T Consensus        20 kVsi~eL~sy~~~~~~~~a~~~Lseal~fak~n~sWrFWiCp~CskkF~d~~~~~~H~~~eH~~~l~   86 (466)
T PF04780_consen   20 KVSIDELKSYYESVYDREAADALSEALSFAKENKSWRFWICPRCSKKFSDAESCLSHMEQEHPAGLK   86 (466)
T ss_pred             eeEHHHHHHHHHhccchHHHHHHHHHHHHHHhcCceeEeeCCcccceeCCHHHHHHHHHHhhhhhcC
Confidence            4566777777776665332                 2356999997643  6899999999977764


No 129
>PRK04023 DNA polymerase II large subunit; Validated
Probab=34.43  E-value=19  Score=38.28  Aligned_cols=9  Identities=22%  Similarity=0.589  Sum_probs=4.7

Q ss_pred             ccccccccC
Q 029557           78 GVCPVCVTR   86 (191)
Q Consensus        78 vVCPICa~~   86 (191)
                      ..||-|-..
T Consensus       664 y~CPKCG~E  672 (1121)
T PRK04023        664 DECEKCGRE  672 (1121)
T ss_pred             CcCCCCCCC
Confidence            346666543


No 130
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=33.86  E-value=22  Score=25.65  Aligned_cols=31  Identities=29%  Similarity=0.750  Sum_probs=20.0

Q ss_pred             ceecCCCCCC-CcCHHHHHhhhhhcCCCCCCcccccccc
Q 029557           47 YEYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCV   84 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa   84 (191)
                      ..|+||-||+ .+-.-.-|.-       ..+.-+||-|-
T Consensus        26 v~F~CPnCGe~~I~Rc~~CRk-------~g~~Y~Cp~CG   57 (61)
T COG2888          26 VKFPCPNCGEVEIYRCAKCRK-------LGNPYRCPKCG   57 (61)
T ss_pred             eEeeCCCCCceeeehhhhHHH-------cCCceECCCcC
Confidence            6899999997 5544333321       24556888883


No 131
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=33.47  E-value=37  Score=32.54  Aligned_cols=48  Identities=31%  Similarity=0.578  Sum_probs=32.6

Q ss_pred             eecCCCCCCC-cCHHHHHhhhhhcCCCCCCcccccccccCcc--cchHhhhh
Q 029557           48 EYPCPFCSED-FDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT--MDMVDHIT   96 (191)
Q Consensus        48 ~F~CPfC~e~-~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~--~d~v~Hl~   96 (191)
                      .|+||.|+-. =-..+|-.|+.-.|.- .|.-.|--|...--  .|+..|+.
T Consensus       263 ~ykCplCdmtc~~~ssL~~H~r~rHs~-dkpfKCd~Cd~~c~~esdL~kH~~  313 (467)
T KOG3608|consen  263 CYKCPLCDMTCSSASSLTTHIRYRHSK-DKPFKCDECDTRCVRESDLAKHVQ  313 (467)
T ss_pred             cccccccccCCCChHHHHHHHHhhhcc-CCCccccchhhhhccHHHHHHHHH
Confidence            5888888773 3456788888888876 66777887766422  35555554


No 132
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=33.35  E-value=17  Score=22.89  Aligned_cols=25  Identities=20%  Similarity=0.535  Sum_probs=15.4

Q ss_pred             ceecCCCCCCCcCH-----HHHHhhhhhcC
Q 029557           47 YEYPCPFCSEDFDL-----VGLCCHIDEEH   71 (191)
Q Consensus        47 ~~F~CPfC~e~~D~-----~~L~~H~~eeH   71 (191)
                      ....|-||+..+..     ..|..|+...|
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            45788888885544     47788876665


No 133
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=33.28  E-value=22  Score=24.30  Aligned_cols=12  Identities=25%  Similarity=0.958  Sum_probs=10.2

Q ss_pred             ccCcceecCCCCCC
Q 029557           43 VKGEYEYPCPFCSE   56 (191)
Q Consensus        43 ~~~~~~F~CPfC~e   56 (191)
                      +-  .+|.||-|+.
T Consensus        31 Lp--~~w~CP~C~a   42 (50)
T cd00730          31 LP--DDWVCPVCGA   42 (50)
T ss_pred             CC--CCCCCCCCCC
Confidence            55  6899999997


No 134
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=33.10  E-value=14  Score=31.36  Aligned_cols=23  Identities=22%  Similarity=0.239  Sum_probs=0.0

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhc
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEE   70 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~ee   70 (191)
                      ...||+||+-+-+..+-.|++-+
T Consensus       168 ~~~cPitGe~IP~~e~~eHmRi~  190 (229)
T PF12230_consen  168 MIICPITGEMIPADEMDEHMRIE  190 (229)
T ss_dssp             -----------------------
T ss_pred             ccccccccccccccccccccccc
Confidence            47999999999999999998743


No 135
>PF12660 zf-TFIIIC:  Putative zinc-finger of transcription factor IIIC complex;  InterPro: IPR024764 This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins. This domain might be involved in protein-DNA and/or protein-protein interactions [].; PDB: 2J04_C.
Probab=32.27  E-value=8.3  Score=29.37  Aligned_cols=38  Identities=29%  Similarity=0.630  Sum_probs=11.8

Q ss_pred             cCCCCCCCcCHHHHH-hhhhhcCCC-----------CCCcccccccccCc
Q 029557           50 PCPFCSEDFDLVGLC-CHIDEEHPV-----------EAKSGVCPVCVTRV   87 (191)
Q Consensus        50 ~CPfC~e~~D~~~L~-~H~~eeH~~-----------e~k~vVCPICa~~~   87 (191)
                      .||+|++.+....+. .=|..-|.+           +++.-+|++|..+.
T Consensus        16 ~C~~C~~~i~~~~~~~~~C~~GH~w~RC~lT~l~i~~~~~r~C~~C~~~~   65 (99)
T PF12660_consen   16 KCPICGAPIPFDDLDEAQCENGHVWPRCALTFLPIQTPGVRVCPVCGRRA   65 (99)
T ss_dssp             -------------SSEEE-TTS-EEEB-SSS-SBS-SS-EEE-TTT--EE
T ss_pred             cccccccccccCCcCEeECCCCCEEeeeeeeeeeeccCCeeEcCCCCCEE
Confidence            599999977765543 446777755           55567899997654


No 136
>PRK00907 hypothetical protein; Provisional
Probab=31.79  E-value=22  Score=27.03  Aligned_cols=28  Identities=18%  Similarity=0.218  Sum_probs=19.2

Q ss_pred             cchhhhccCcceecCCCCCC--CcCHHHHHhhh
Q 029557           37 EDDYEEVKGEYEYPCPFCSE--DFDLVGLCCHI   67 (191)
Q Consensus        37 ~d~d~e~~~~~~F~CPfC~e--~~D~~~L~~H~   67 (191)
                      .|++|++.   +|||.|..+  |.+..+|...+
T Consensus         5 ~~~~~~li---EFPc~fpiKVmG~a~~~l~~~V   34 (92)
T PRK00907          5 SDNPDHGF---QFPGTFELSAMGTAERGLETEL   34 (92)
T ss_pred             cCCCCccE---ecCCCCeEEEEEcCchhHHHHH
Confidence            34444455   799999988  87777766544


No 137
>PHA00733 hypothetical protein
Probab=31.22  E-value=39  Score=26.73  Aligned_cols=25  Identities=20%  Similarity=0.453  Sum_probs=21.5

Q ss_pred             eecCCCCCCC-cCHHHHHhhhhhcCC
Q 029557           48 EYPCPFCSED-FDLVGLCCHIDEEHP   72 (191)
Q Consensus        48 ~F~CPfC~e~-~D~~~L~~H~~eeH~   72 (191)
                      .|.|+.|++. -....|..|+...|.
T Consensus        99 ~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         99 SKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CccCCCCCCccCCHHHHHHHHHHhcC
Confidence            5999999994 566889999999985


No 138
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.19  E-value=11  Score=28.45  Aligned_cols=46  Identities=24%  Similarity=0.525  Sum_probs=31.4

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcccchHhhhhcccccchhh
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNS  105 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~~d~v~Hl~~qH~~~~K~  105 (191)
                      ..|.|--|+..+|+..        |-.|.-...||-|.+++.+-|     .+=|..||+
T Consensus        11 Y~Y~c~~cg~~~dvvq--------~~~ddplt~ce~c~a~~kk~l-----~~vgi~fKG   56 (82)
T COG2331          11 YSYECTECGNRFDVVQ--------AMTDDPLTTCEECGARLKKLL-----NAVGIVFKG   56 (82)
T ss_pred             eEEeecccchHHHHHH--------hcccCccccChhhChHHHHhh-----ccceEEEec
Confidence            4689999999888753        334566789999988654322     344556664


No 139
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=30.74  E-value=24  Score=34.28  Aligned_cols=40  Identities=30%  Similarity=0.620  Sum_probs=25.3

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhc--CCCCCCcccccccccCcc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEE--HPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~ee--H~~e~k~vVCPICa~~~~   88 (191)
                      -..+||-||+.+.+.  ..++.-.  ...+.-..+||-|-..+.
T Consensus       199 ~~vpCPhCg~~~~l~--~~~l~w~~~~~~~~a~y~C~~Cg~~i~  240 (557)
T PF05876_consen  199 YYVPCPHCGEEQVLE--WENLKWDKGEAPETARYVCPHCGCEIE  240 (557)
T ss_pred             EEccCCCCCCCcccc--ccceeecCCCCccceEEECCCCcCCCC
Confidence            468999999955443  2223222  133444578999988775


No 140
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=30.71  E-value=28  Score=31.37  Aligned_cols=30  Identities=30%  Similarity=0.509  Sum_probs=22.7

Q ss_pred             ccCcceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           43 VKGEYEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        43 ~~~~~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      +|    ..||-|++-+-..+|..          +.-|||-|...
T Consensus        25 ~~----~~c~~c~~~~~~~~l~~----------~~~vc~~c~~h   54 (285)
T TIGR00515        25 VW----TKCPKCGQVLYTKELER----------NLEVCPKCDHH   54 (285)
T ss_pred             Ce----eECCCCcchhhHHHHHh----------hCCCCCCCCCc
Confidence            77    78999999776666543          34699999763


No 141
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=30.46  E-value=28  Score=24.33  Aligned_cols=38  Identities=29%  Similarity=0.488  Sum_probs=24.3

Q ss_pred             ceecCCCCCCCcCHHHHHhhh------------------hhcCCCCCCccccccccc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHI------------------DEEHPVEAKSGVCPVCVT   85 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~------------------~eeH~~e~k~vVCPICa~   85 (191)
                      ..-.||+|.-.+|...|..=.                  .+.|..+ ...+||.|..
T Consensus         6 niL~Cp~ck~pL~~~~l~~~~~~~~~~lp~~~~~~~~~l~~~~i~e-g~L~Cp~c~r   61 (68)
T PF03966_consen    6 NILACPVCKGPLDWEALVETAQLGLSELPKELPEDYHVLLEVEIVE-GELICPECGR   61 (68)
T ss_dssp             GTBB-TTTSSBEHHHHHHHHHHCCCCHCHHCHHCHCEHHCTEETTT-TEEEETTTTE
T ss_pred             hhhcCCCCCCcchHHHHHHHHHhCcccCCCCCccchhhhhcccccC-CEEEcCCCCC
Confidence            467899998888767766622                  2234444 4579999953


No 142
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=30.22  E-value=28  Score=29.53  Aligned_cols=29  Identities=31%  Similarity=0.561  Sum_probs=21.2

Q ss_pred             ceecCCCCCC--CcCHHHHHhhhhhcCCCCCCcccccccccCc
Q 029557           47 YEYPCPFCSE--DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRV   87 (191)
Q Consensus        47 ~~F~CPfC~e--~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~   87 (191)
                      ..|.||-|..  .||.+-+..            -.||.|-+.+
T Consensus       112 ~~y~C~~~~~r~sfdeA~~~~------------F~Cp~Cg~~L  142 (176)
T COG1675         112 NYYVCPNCHVKYSFDEAMELG------------FTCPKCGEDL  142 (176)
T ss_pred             CceeCCCCCCcccHHHHHHhC------------CCCCCCCchh
Confidence            5799999998  555554433            6899997754


No 143
>KOG4696 consensus Uncharacterized conserved protein [Function unknown]
Probab=30.16  E-value=28  Score=32.60  Aligned_cols=23  Identities=35%  Similarity=0.856  Sum_probs=19.9

Q ss_pred             ecCCCCCCCcCHHHHHhhhhhcCC
Q 029557           49 YPCPFCSEDFDLVGLCCHIDEEHP   72 (191)
Q Consensus        49 F~CPfC~e~~D~~~L~~H~~eeH~   72 (191)
                      .-||||.-.+...++|.|++ .|-
T Consensus         3 ~iCP~CkLsv~~~~m~~Hie-aHF   25 (393)
T KOG4696|consen    3 IICPFCKLSVNYDEMCFHIE-AHF   25 (393)
T ss_pred             ccccceecccCHHHHHHHHH-hhc
Confidence            56999999999999999998 454


No 144
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=30.04  E-value=12  Score=29.68  Aligned_cols=39  Identities=23%  Similarity=0.716  Sum_probs=24.1

Q ss_pred             CCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcc---------------cchHhhhhcccccchh
Q 029557           51 CPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT---------------MDMVDHITTQHGNISN  104 (191)
Q Consensus        51 CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~---------------~d~v~Hl~~qH~~~~K  104 (191)
                      ||.||..+-+..               ..||-|...+-               .+|+.-+-...|++=.
T Consensus         1 CPvCg~~l~vt~---------------l~C~~C~t~i~G~F~l~~~~~L~~E~~~Fi~~Fi~~rGnlKe   54 (113)
T PF09862_consen    1 CPVCGGELVVTR---------------LKCPSCGTEIEGEFELPWFARLSPEQLEFIKLFIKNRGNLKE   54 (113)
T ss_pred             CCCCCCceEEEE---------------EEcCCCCCEEEeeeccchhhcCCHHHHHHHHHHHHhcCCHHH
Confidence            899988776544               45666655432               4666666666666533


No 145
>PF04267 SoxD:  Sarcosine oxidase, delta subunit family ;  InterPro: IPR006279 These sequences represent the delta subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Rhizobium loti (Mesorhizobium loti) and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members share the same function. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate [].  Bacterial sarcosine oxidases have been isolated from over a dozen different organisms and fall into two major classes (1) monomeric form that contains only covalent flavin and (2) heterotetrameric (alpha, beta, gamma, delta) form that contain a covalent and noncovalent flavin, this entry represents the heterotetrameric form.; GO: 0008115 sarcosine oxidase activity, 0046653 tetrahydrofolate metabolic process; PDB: 3AD7_D 1X31_D 1VRQ_D 3AD8_D 3ADA_D 3AD9_D 2GAG_D 2GAH_D.
Probab=30.00  E-value=14  Score=27.93  Aligned_cols=8  Identities=50%  Similarity=1.551  Sum_probs=5.3

Q ss_pred             ecCCCCCC
Q 029557           49 YPCPFCSE   56 (191)
Q Consensus        49 F~CPfC~e   56 (191)
                      .+|||||.
T Consensus         2 I~CP~CG~    9 (84)
T PF04267_consen    2 IPCPHCGP    9 (84)
T ss_dssp             EEETTTEE
T ss_pred             ccCCCCCc
Confidence            46777776


No 146
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=29.78  E-value=15  Score=35.70  Aligned_cols=33  Identities=27%  Similarity=0.614  Sum_probs=28.9

Q ss_pred             ceecCCCCCC-CcCHHHHHhhhhhcCCCCCCccc
Q 029557           47 YEYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGV   79 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vV   79 (191)
                      +.|+|-||-. =+...+|-.|++..|+.+.++|.
T Consensus       457 q~f~~ky~~atfyss~~ltrhin~~Hpse~rqv~  490 (500)
T KOG3993|consen  457 QGFTCKYCPATFYSSPGLTRHINKCHPSELRQVA  490 (500)
T ss_pred             hccccccchHhhhcCcchHhHhhhcChHHhhhhH
Confidence            6799999988 77888999999999999988864


No 147
>PLN02751 glutamyl-tRNA(Gln) amidotransferase
Probab=29.77  E-value=25  Score=34.70  Aligned_cols=21  Identities=29%  Similarity=0.504  Sum_probs=16.8

Q ss_pred             hhcCCCCCCcccccccccCcc
Q 029557           68 DEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        68 ~eeH~~e~k~vVCPICa~~~~   88 (191)
                      ..+...+++.-|||||...||
T Consensus        84 ~~~~g~~PNt~vcpvclg~PG  104 (544)
T PLN02751         84 PYNYGAEPNTTVCPVCMGLPG  104 (544)
T ss_pred             CcccCCCCccCcCccccCCCC
Confidence            334455788999999999988


No 148
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=29.73  E-value=7.4  Score=24.40  Aligned_cols=11  Identities=18%  Similarity=0.543  Sum_probs=4.1

Q ss_pred             CCCCCCCcCHH
Q 029557           51 CPFCSEDFDLV   61 (191)
Q Consensus        51 CPfC~e~~D~~   61 (191)
                      |++|++.+...
T Consensus         1 C~~C~~~~~~~   11 (47)
T PF01844_consen    1 CQYCGKPGSDN   11 (47)
T ss_dssp             -TTT--B--GG
T ss_pred             CCCCCCcCccC
Confidence            78888865554


No 149
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=29.59  E-value=35  Score=22.84  Aligned_cols=29  Identities=21%  Similarity=0.594  Sum_probs=17.9

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCccccccc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVC   83 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPIC   83 (191)
                      .-+.||.|+-++...-=       .++ .+...||.|
T Consensus        27 v~W~C~~Cgh~w~~~v~-------~R~-~~~~~CP~C   55 (55)
T PF14311_consen   27 VWWKCPKCGHEWKASVN-------DRT-RRGKGCPYC   55 (55)
T ss_pred             EEEECCCCCCeeEccHh-------hhc-cCCCCCCCC
Confidence            45899999875543211       111 456789988


No 150
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold. It is involved in the oxidative protein folding pathway in prokaryotes, and is the strongest thiol oxidant known, due to the unusual stability of the thiolate anion form of the first cysteine in the CXXC motif. The highly unstable oxidized form of DsbA directly donates disulfide bonds to reduced proteins secreted into the bacterial periplasm. This rapid and unidirectional process helps to catalyze the folding of newly-synthesized polypeptides. To regain catalytic activity, reduced DsbA is then reoxidized by the membrane protein DsbB, which generates its disulfides from oxidized quinones, which in turn are reoxidized by the electron transport chain.
Probab=29.57  E-value=20  Score=27.74  Aligned_cols=19  Identities=26%  Similarity=0.618  Sum_probs=13.4

Q ss_pred             ceecCCCCCC-CcCHHHHHh
Q 029557           47 YEYPCPFCSE-DFDLVGLCC   65 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~   65 (191)
                      ..|.||+|.. .=.+..|..
T Consensus        23 ~D~~Cp~C~~~~~~~~~~~~   42 (178)
T cd03019          23 FSYGCPHCYNFEPILEAWVK   42 (178)
T ss_pred             ECCCCcchhhhhHHHHHHHH
Confidence            4699999998 555555544


No 151
>PF11290 DUF3090:  Protein of unknown function (DUF3090);  InterPro: IPR021441  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=29.26  E-value=27  Score=29.69  Aligned_cols=13  Identities=46%  Similarity=1.099  Sum_probs=10.4

Q ss_pred             ecCCCCCCCcCHH
Q 029557           49 YPCPFCSEDFDLV   61 (191)
Q Consensus        49 F~CPfC~e~~D~~   61 (191)
                      =+||+||.-+|-.
T Consensus       155 P~CPlCg~PlDP~  167 (171)
T PF11290_consen  155 PPCPLCGEPLDPE  167 (171)
T ss_pred             CCCCCCCCCCCCC
Confidence            4799999987754


No 152
>TIGR01374 soxD sarcosine oxidase, delta subunit family, heterotetrameric form. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) form
Probab=29.19  E-value=25  Score=26.68  Aligned_cols=8  Identities=50%  Similarity=1.767  Sum_probs=6.0

Q ss_pred             ecCCCCCC
Q 029557           49 YPCPFCSE   56 (191)
Q Consensus        49 F~CPfC~e   56 (191)
                      .+||+||.
T Consensus         2 I~CP~CG~    9 (84)
T TIGR01374         2 IPCPYCGP    9 (84)
T ss_pred             ccCCCCCC
Confidence            47888885


No 153
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=29.18  E-value=27  Score=23.58  Aligned_cols=10  Identities=30%  Similarity=1.109  Sum_probs=7.0

Q ss_pred             ceecCCCCCC
Q 029557           47 YEYPCPFCSE   56 (191)
Q Consensus        47 ~~F~CPfC~e   56 (191)
                      ..|.||-|+.
T Consensus        33 ~~w~CP~C~a   42 (47)
T PF00301_consen   33 DDWVCPVCGA   42 (47)
T ss_dssp             TT-B-TTTSS
T ss_pred             CCCcCcCCCC
Confidence            6799999987


No 154
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=29.18  E-value=21  Score=23.49  Aligned_cols=9  Identities=33%  Similarity=1.206  Sum_probs=7.3

Q ss_pred             eecCCCCCC
Q 029557           48 EYPCPFCSE   56 (191)
Q Consensus        48 ~F~CPfC~e   56 (191)
                      .-.||||+.
T Consensus        29 ~~~CpYCg~   37 (40)
T PF10276_consen   29 PVVCPYCGT   37 (40)
T ss_dssp             EEEETTTTE
T ss_pred             eEECCCCCC
Confidence            378999985


No 155
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=28.71  E-value=34  Score=18.79  Aligned_cols=16  Identities=19%  Similarity=0.698  Sum_probs=6.8

Q ss_pred             ccccccCcc--cchHhhh
Q 029557           80 CPVCVTRVT--MDMVDHI   95 (191)
Q Consensus        80 CPICa~~~~--~d~v~Hl   95 (191)
                      |.||-....  ..|..|+
T Consensus         3 C~~C~~~f~s~~~~~~H~   20 (25)
T PF12874_consen    3 CDICNKSFSSENSLRQHL   20 (25)
T ss_dssp             ETTTTEEESSHHHHHHHH
T ss_pred             CCCCCCCcCCHHHHHHHH
Confidence            555533322  2444444


No 156
>PF09706 Cas_CXXC_CXXC:  CRISPR-associated protein (Cas_CXXC_CXXC);  InterPro: IPR019121 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.  This entry represents a conserved domain of about 65 amino acids found in otherwise highly divergent proteins encoded in CRISPR-associated regions. This domain features two CXXC motifs. 
Probab=28.58  E-value=21  Score=25.52  Aligned_cols=10  Identities=50%  Similarity=1.245  Sum_probs=8.2

Q ss_pred             ceecCCCCCC
Q 029557           47 YEYPCPFCSE   56 (191)
Q Consensus        47 ~~F~CPfC~e   56 (191)
                      ..+.|-+||+
T Consensus         4 ~~~~C~~Cg~   13 (69)
T PF09706_consen    4 KKYNCIFCGE   13 (69)
T ss_pred             CCCcCcCCCC
Confidence            5689999994


No 157
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=28.08  E-value=18  Score=27.21  Aligned_cols=37  Identities=16%  Similarity=0.343  Sum_probs=18.9

Q ss_pred             CCCCCCCcCHHHHHhhhhhcCC----CCCCcccccccccCc
Q 029557           51 CPFCSEDFDLVGLCCHIDEEHP----VEAKSGVCPVCVTRV   87 (191)
Q Consensus        51 CPfC~e~~D~~~L~~H~~eeH~----~e~k~vVCPICa~~~   87 (191)
                      ||+|+.+--+.....+.....-    .+....+||.|-...
T Consensus         1 C~~C~~~~~~~~~~~~~~~~~G~~~~v~~~~~~C~~CGe~~   41 (127)
T TIGR03830         1 CPICGSGELVRDVKDEPYTYKGESITIGVPGWYCPACGEEL   41 (127)
T ss_pred             CCCCCCccceeeeecceEEEcCEEEEEeeeeeECCCCCCEE
Confidence            9999863333333332211111    133346799997754


No 158
>cd03021 DsbA_GSTK DsbA family, Glutathione (GSH) S-transferase Kappa (GSTK) subfamily; GSTK is a member of the GST family of enzymes which catalyzes the transfer of the thiol of GSH to electrophilic substrates. It is specifically located in the mitochondria and peroxisomes, unlike other members of the canonical GST family, which are mainly cytosolic. The biological substrates of GSTK are not yet known. It is presumed to have a protective role during respiration when large amounts of reactive oxygen species are generated. GSTK has the same general fold as DsbA, consisting of a thioredoxin domain interrupted by an alpha-helical domain and its biological unit is a homodimer. GSTK is closely related to the bacterial enzyme, 2-hydroxychromene-2-carboxylate (HCCA) isomerase. It shows little sequence similarity to the other members of the GST family.
Probab=28.06  E-value=13  Score=30.65  Aligned_cols=13  Identities=15%  Similarity=0.391  Sum_probs=10.8

Q ss_pred             ccCcceecCCCCCCC
Q 029557           43 VKGEYEYPCPFCSED   57 (191)
Q Consensus        43 ~~~~~~F~CPfC~e~   57 (191)
                      +.  ..|.||||+.+
T Consensus         5 ~~--~D~vcPwcylg   17 (209)
T cd03021           5 LY--YDVVSPYSYLA   17 (209)
T ss_pred             EE--EeCCChHHHHH
Confidence            55  78999999984


No 159
>PF09334 tRNA-synt_1g:  tRNA synthetases class I (M);  InterPro: IPR015413 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This domain is found in methionyl and leucyl tRNA synthetases. ; GO: 0000166 nucleotide binding, 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0006418 tRNA aminoacylation for protein translation, 0005737 cytoplasm; PDB: 2D5B_A 1A8H_A 1WOY_A 2D54_A 4DLP_A 2CT8_B 2CSX_A 1MED_A 1PFU_A 1PFW_A ....
Probab=28.03  E-value=14  Score=34.11  Aligned_cols=40  Identities=25%  Similarity=0.524  Sum_probs=26.2

Q ss_pred             ecCCCCCCCcCHHHHHhhhhhcC-CCCCCcccccccccCcc
Q 029557           49 YPCPFCSEDFDLVGLCCHIDEEH-PVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        49 F~CPfC~e~~D~~~L~~H~~eeH-~~e~k~vVCPICa~~~~   88 (191)
                      =.||+|+.+---...|++|-... +.+..+.+|.+|...+.
T Consensus       137 g~CP~C~~~~a~g~~Ce~cG~~~~~~~l~~p~~~~~g~~~~  177 (391)
T PF09334_consen  137 GTCPYCGSDKARGDQCENCGRPLEPEELINPVCKICGSPPE  177 (391)
T ss_dssp             CEETTT--SSCTTTEETTTSSBEECCCSECEEETTTS-B-E
T ss_pred             ccccCcCccccCCCcccCCCCCcccccccCCccccccccCc
Confidence            57999996555556777776544 36778899999987664


No 160
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=27.81  E-value=38  Score=30.99  Aligned_cols=29  Identities=21%  Similarity=0.200  Sum_probs=22.6

Q ss_pred             ccCcceecCCCCCCCcCHHHHHhhhhhcCCCCCCccccccccc
Q 029557           43 VKGEYEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVT   85 (191)
Q Consensus        43 ~~~~~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~   85 (191)
                      +|    ..||-|++-+-...|-.          +.-|||-|..
T Consensus        37 lw----~kc~~C~~~~~~~~l~~----------~~~vcp~c~~   65 (296)
T CHL00174         37 LW----VQCENCYGLNYKKFLKS----------KMNICEQCGY   65 (296)
T ss_pred             Ce----eECCCccchhhHHHHHH----------cCCCCCCCCC
Confidence            67    78999999777777643          3469999976


No 161
>TIGR00133 gatB glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit. The heterotrimer GatABC is responsible for transferring the NH2 group that converts Glu to Gln, or Asp to Asn after the Glu or Asp has been ligated to the tRNA for Gln or Asn, respectively. In Lactobacillus, GatABC is responsible only for tRNA(Gln). In the Archaea, GatABC is responsible only for tRNA(Asn), while GatDE is responsible for tRNA(Gln). In lineages that include Thermus, Chlamydia, or Acidithiobacillus, the GatABC complex catalyzes both.
Probab=27.52  E-value=29  Score=33.56  Aligned_cols=15  Identities=33%  Similarity=0.789  Sum_probs=13.8

Q ss_pred             CCCcccccccccCcc
Q 029557           74 EAKSGVCPVCVTRVT   88 (191)
Q Consensus        74 e~k~vVCPICa~~~~   88 (191)
                      +++..|||||...||
T Consensus        34 ~PNt~v~pvclg~PG   48 (478)
T TIGR00133        34 PPNTNVCPVCLGLPG   48 (478)
T ss_pred             CCCcccCccccCCCC
Confidence            688899999999988


No 162
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.40  E-value=28  Score=25.17  Aligned_cols=13  Identities=46%  Similarity=0.963  Sum_probs=8.0

Q ss_pred             CCCcccccccccC
Q 029557           74 EAKSGVCPVCVTR   86 (191)
Q Consensus        74 e~k~vVCPICa~~   86 (191)
                      +.+.|+||-|..+
T Consensus        45 ~~gev~CPYC~t~   57 (62)
T COG4391          45 DEGEVVCPYCSTR   57 (62)
T ss_pred             CCCcEecCccccE
Confidence            4556777777553


No 163
>PRK10220 hypothetical protein; Provisional
Probab=27.37  E-value=31  Score=27.54  Aligned_cols=13  Identities=23%  Similarity=0.715  Sum_probs=8.5

Q ss_pred             CCCcccccccccC
Q 029557           74 EAKSGVCPVCVTR   86 (191)
Q Consensus        74 e~k~vVCPICa~~   86 (191)
                      +....|||-|+.-
T Consensus        17 d~~~~vCpeC~hE   29 (111)
T PRK10220         17 DNGMYICPECAHE   29 (111)
T ss_pred             CCCeEECCcccCc
Confidence            3445788888663


No 164
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=27.36  E-value=29  Score=25.10  Aligned_cols=27  Identities=19%  Similarity=0.218  Sum_probs=22.7

Q ss_pred             ceecCCCCCC-CcCHHHHHhhhhhcCCC
Q 029557           47 YEYPCPFCSE-DFDLVGLCCHIDEEHPV   73 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~H~~eeH~~   73 (191)
                      .-|.||-|+. =-+...-..|++..|-.
T Consensus        16 ~~lrCPRC~~~FR~~K~Y~RHVNKaH~~   43 (65)
T COG4049          16 EFLRCPRCGMVFRRRKDYIRHVNKAHGW   43 (65)
T ss_pred             eeeeCCchhHHHHHhHHHHHHhhHHhhh
Confidence            3589999999 66788899999998865


No 165
>PHA02565 49 recombination endonuclease VII; Provisional
Probab=27.35  E-value=26  Score=29.53  Aligned_cols=41  Identities=22%  Similarity=0.464  Sum_probs=26.5

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcC-----CCCC-CcccccccccCc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEH-----PVEA-KSGVCPVCVTRV   87 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH-----~~e~-k~vVCPICa~~~   87 (191)
                      +--.||.|+..++..--..|++=.|     .... +-+.|+-|-...
T Consensus        19 Q~G~CaiC~~~l~~~~~~~~vDHDH~l~g~~TG~VRGLLC~~CN~~l   65 (157)
T PHA02565         19 QNGICPLCKRELDGDVSKNHLDHDHELNGPNAGRVRGLLCNLCNALE   65 (157)
T ss_pred             hCCcCCCCCCccCCCccccccCCCCCCCCcccccccccCchhhhhhh
Confidence            4578999999776432234777777     3322 446799995533


No 166
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=27.07  E-value=20  Score=34.54  Aligned_cols=32  Identities=25%  Similarity=0.513  Sum_probs=21.6

Q ss_pred             ceecCCCCCC---CcCHHHHHhhhhhcCCCCCCccccccccc
Q 029557           47 YEYPCPFCSE---DFDLVGLCCHIDEEHPVEAKSGVCPVCVT   85 (191)
Q Consensus        47 ~~F~CPfC~e---~~D~~~L~~H~~eeH~~e~k~vVCPICa~   85 (191)
                      +.|.||+|..   .||+..|..-       +...-.|-.|-.
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~L~~~-------~~~~F~C~~C~g  161 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQLLDN-------ETGEFHCENCGG  161 (436)
T ss_pred             ccccCCccccchhhhHHHHhhcc-------cCceEEEecCCC
Confidence            6899999999   4555555542       234456777755


No 167
>COG3058 FdhE Uncharacterized protein involved in formate dehydrogenase formation [Posttranslational modification, protein turnover, chaperones]
Probab=26.98  E-value=23  Score=32.58  Aligned_cols=18  Identities=33%  Similarity=0.647  Sum_probs=14.1

Q ss_pred             CcccccccccCcccchHh
Q 029557           76 KSGVCPVCVTRVTMDMVD   93 (191)
Q Consensus        76 k~vVCPICa~~~~~d~v~   93 (191)
                      +..+||||..+|...||.
T Consensus       184 ~~~~CPvCGS~PvaSmV~  201 (308)
T COG3058         184 SRQYCPVCGSMPVASMVQ  201 (308)
T ss_pred             ccccCCCcCCCCcceeee
Confidence            457999999998766663


No 168
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=26.94  E-value=29  Score=25.46  Aligned_cols=8  Identities=38%  Similarity=1.547  Sum_probs=5.3

Q ss_pred             ecCCCCCC
Q 029557           49 YPCPFCSE   56 (191)
Q Consensus        49 F~CPfC~e   56 (191)
                      |.||+||.
T Consensus         2 m~CP~Cg~    9 (72)
T PRK09678          2 FHCPLCQH    9 (72)
T ss_pred             ccCCCCCC
Confidence            46777766


No 169
>PF14369 zf-RING_3:  zinc-finger
Probab=26.79  E-value=31  Score=21.78  Aligned_cols=9  Identities=44%  Similarity=1.250  Sum_probs=7.7

Q ss_pred             cCCCCCCCc
Q 029557           50 PCPFCSEDF   58 (191)
Q Consensus        50 ~CPfC~e~~   58 (191)
                      .||.|+-+|
T Consensus        23 ~CP~C~~gF   31 (35)
T PF14369_consen   23 ACPRCHGGF   31 (35)
T ss_pred             CCcCCCCcE
Confidence            699999876


No 170
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=26.76  E-value=32  Score=37.32  Aligned_cols=36  Identities=28%  Similarity=0.659  Sum_probs=20.3

Q ss_pred             eecCCCCCC-CcCHHHHHhhhhhcCCCCCCcccccccccCcc
Q 029557           48 EYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        48 ~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      .|.||-||. .+.  ..|..|-..  .++ ..+||.|-+.+.
T Consensus       667 ~rkCPkCG~~t~~--~fCP~CGs~--te~-vy~CPsCGaev~  703 (1337)
T PRK14714        667 RRRCPSCGTETYE--NRCPDCGTH--TEP-VYVCPDCGAEVP  703 (1337)
T ss_pred             EEECCCCCCcccc--ccCcccCCc--CCC-ceeCccCCCccC
Confidence            588999988 332  356555543  111 236777766543


No 171
>PF13462 Thioredoxin_4:  Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A ....
Probab=26.25  E-value=6.1  Score=30.08  Aligned_cols=21  Identities=24%  Similarity=0.719  Sum_probs=17.0

Q ss_pred             ceecCCCCCC-CcCHHHHHhhh
Q 029557           47 YEYPCPFCSE-DFDLVGLCCHI   67 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~H~   67 (191)
                      ..|.||+|.. .-.+..|..+.
T Consensus        20 ~d~~Cp~C~~~~~~~~~~~~~~   41 (162)
T PF13462_consen   20 FDFQCPHCAKFHEELEKLLKKY   41 (162)
T ss_dssp             E-TTSHHHHHHHHHHHHHHHHH
T ss_pred             ECCCCHhHHHHHHHHhhhhhhc
Confidence            4699999999 77777888885


No 172
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=26.25  E-value=50  Score=20.75  Aligned_cols=31  Identities=19%  Similarity=0.546  Sum_probs=18.1

Q ss_pred             ecCCCCCCCcCHHHHHhhhhhcCCCCCCccccccccc
Q 029557           49 YPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVT   85 (191)
Q Consensus        49 F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~   85 (191)
                      +.||-|+..|++.+=.      =+.....|-||.|..
T Consensus         3 i~Cp~C~~~y~i~d~~------ip~~g~~v~C~~C~~   33 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK------IPPKGRKVRCSKCGH   33 (36)
T ss_pred             EECCCCCCEEeCCHHH------CCCCCcEEECCCCCC
Confidence            6788888855443211      123455677888854


No 173
>cd03024 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif. It is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins.
Probab=26.10  E-value=18  Score=28.88  Aligned_cols=21  Identities=19%  Similarity=0.422  Sum_probs=16.0

Q ss_pred             ceecCCCCCC-CcCHHHHHhhh
Q 029557           47 YEYPCPFCSE-DFDLVGLCCHI   67 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~~H~   67 (191)
                      ..|.||||+. .-.+..+....
T Consensus         5 ~D~~cP~cyl~~~~l~~~~~~~   26 (201)
T cd03024           5 SDVVCPWCYIGKRRLEKALAEL   26 (201)
T ss_pred             ecCcCccHHHHHHHHHHHHHhC
Confidence            6799999998 55666676555


No 174
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=25.97  E-value=22  Score=27.62  Aligned_cols=12  Identities=25%  Similarity=0.429  Sum_probs=6.9

Q ss_pred             ceecCCCCCCCc
Q 029557           47 YEYPCPFCSEDF   58 (191)
Q Consensus        47 ~~F~CPfC~e~~   58 (191)
                      ..+.|+-|+..|
T Consensus        69 ~~~~C~~Cg~~~   80 (114)
T PRK03681         69 AECWCETCQQYV   80 (114)
T ss_pred             cEEEcccCCCee
Confidence            346666666633


No 175
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=25.65  E-value=39  Score=30.56  Aligned_cols=30  Identities=27%  Similarity=0.525  Sum_probs=22.4

Q ss_pred             ccCcceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           43 VKGEYEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        43 ~~~~~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      +|    -.||-|++-+-...|-.          +.-|||-|-..
T Consensus        26 ~~----~~c~~c~~~~~~~~l~~----------~~~vc~~c~~h   55 (292)
T PRK05654         26 LW----TKCPSCGQVLYRKELEA----------NLNVCPKCGHH   55 (292)
T ss_pred             Ce----eECCCccchhhHHHHHh----------cCCCCCCCCCC
Confidence            77    89999999776666543          23699999763


No 176
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=25.60  E-value=23  Score=27.29  Aligned_cols=13  Identities=31%  Similarity=0.887  Sum_probs=10.7

Q ss_pred             ccCcceecCCCCCCC
Q 029557           43 VKGEYEYPCPFCSED   57 (191)
Q Consensus        43 ~~~~~~F~CPfC~e~   57 (191)
                      .+  +.+.||+|+..
T Consensus        32 ~~--~~~~Cp~C~~~   44 (89)
T COG1997          32 QR--AKHVCPFCGRT   44 (89)
T ss_pred             Hh--cCCcCCCCCCc
Confidence            55  78999999873


No 177
>PHA02929 N1R/p28-like protein; Provisional
Probab=25.42  E-value=13  Score=32.90  Aligned_cols=41  Identities=24%  Similarity=0.482  Sum_probs=23.5

Q ss_pred             ceecCCCCCCCcCHH----------HHHhhhhhcCCC---CCCcccccccccCc
Q 029557           47 YEYPCPFCSEDFDLV----------GLCCHIDEEHPV---EAKSGVCPVCVTRV   87 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~----------~L~~H~~eeH~~---e~k~vVCPICa~~~   87 (191)
                      ....||.|.+.+...          .=|.|.--..+.   -.....||+|...+
T Consensus       173 ~~~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~Wl~~~~tCPlCR~~~  226 (238)
T PHA02929        173 KDKECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKKEKNTCPVCRTPF  226 (238)
T ss_pred             CCCCCccCCcccccCccccccceecCCCCCcccHHHHHHHHhcCCCCCCCCCEe
Confidence            357899999965432          125553222221   12346899997754


No 178
>PF02934 GatB_N:  GatB/GatE catalytic domain;  InterPro: IPR006075 Glutamyl-tRNA(Gln) amidotransferase subunit B (6.3.5 from EC) [] is a microbial enzyme that furnishes a means for formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln). The enzyme is composed of three subunits: A (an amidase), B and C. It also exists in eukaryotes as a protein targeted to the mitochondria. ; GO: 0016874 ligase activity; PDB: 3H0M_H 3H0R_K 3H0L_K 3AL0_B 3IP4_B 2DF4_B 2G5I_B 2F2A_B 2G5H_B 2DQN_B ....
Probab=25.23  E-value=28  Score=31.74  Aligned_cols=23  Identities=30%  Similarity=0.587  Sum_probs=15.4

Q ss_pred             hhhhcCCCCCCcccccccccCcc
Q 029557           66 HIDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        66 H~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      .|......+++.-|||+|...||
T Consensus        21 ~c~~~~~~~pNt~v~~~~lg~PG   43 (289)
T PF02934_consen   21 SCPNEFGAEPNTNVCPVCLGLPG   43 (289)
T ss_dssp             SSBSSTTSCTTSSB-TTTTT-TT
T ss_pred             CCCCCCCCCCccccCceeccCCC
Confidence            34444444788899999999987


No 179
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=24.32  E-value=39  Score=22.19  Aligned_cols=25  Identities=24%  Similarity=0.670  Sum_probs=14.8

Q ss_pred             eecCCCCCCCcCHH------HHHhhhhhcCC
Q 029557           48 EYPCPFCSEDFDLV------GLCCHIDEEHP   72 (191)
Q Consensus        48 ~F~CPfC~e~~D~~------~L~~H~~eeH~   72 (191)
                      .-.|-+|+..+...      .|..|+...|+
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~~h~   48 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRRKHP   48 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHhHCc
Confidence            45677777755443      56666665554


No 180
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins. Members of this family contain a redox active CXXC motif (except GSTK and HCCA isomerase) imbedded in a TRX fold, and an alpha helical insert of about 75 residues (shorter in DsbC and DsbG) relative to TRX. DsbA is involved in the oxidative protein folding pathway in prokaryotes, catalyzing disulfide bond formation of proteins secreted into the bacterial periplasm. DsbC and DsbG function as protein disulfide isomerases and chaperones to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins.
Probab=24.28  E-value=19  Score=24.14  Aligned_cols=18  Identities=28%  Similarity=0.713  Sum_probs=12.3

Q ss_pred             ceecCCCCCC-CcCHHHHH
Q 029557           47 YEYPCPFCSE-DFDLVGLC   64 (191)
Q Consensus        47 ~~F~CPfC~e-~~D~~~L~   64 (191)
                      ..|.||||.. .-.+..+.
T Consensus         5 ~d~~Cp~C~~~~~~l~~~~   23 (98)
T cd02972           5 FDPLCPYCYLFEPELEKLL   23 (98)
T ss_pred             ECCCCHhHHhhhHHHHHHH
Confidence            4689999998 44444444


No 181
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=23.96  E-value=30  Score=35.19  Aligned_cols=38  Identities=29%  Similarity=0.587  Sum_probs=25.2

Q ss_pred             ceecCCCCCCCcC----HHHHHhhhhhcCCCCCCcccccccccC
Q 029557           47 YEYPCPFCSEDFD----LVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        47 ~~F~CPfC~e~~D----~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      ..+.||.|+..+.    ...|.||-=..+  +...-.||=|-..
T Consensus       443 ~v~~Cp~Cd~~lt~H~~~~~L~CH~Cg~~--~~~p~~Cp~Cgs~  484 (730)
T COG1198         443 YIAECPNCDSPLTLHKATGQLRCHYCGYQ--EPIPQSCPECGSE  484 (730)
T ss_pred             CcccCCCCCcceEEecCCCeeEeCCCCCC--CCCCCCCCCCCCC
Confidence            4689999998443    345555433333  5667899999775


No 182
>cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway. It converts HCCA, a hemiketal formed spontaneously after ring cleavage of 1,2-dihydroxynapthalene by a dioxygenase, into cis-o-hydroxybenzylidenepyruvate (cHBPA). This is the fourth reaction in a six-step pathway that converts napthalene into salicylate. HCCA isomerase is unique to bacteria that degrade polycyclic aromatic compounds. It is closely related to the eukaryotic protein, GSH transferase kappa (GSTK).
Probab=23.69  E-value=18  Score=28.50  Aligned_cols=20  Identities=15%  Similarity=0.486  Sum_probs=13.6

Q ss_pred             ceecCCCCCCCc-CHHHHHhh
Q 029557           47 YEYPCPFCSEDF-DLVGLCCH   66 (191)
Q Consensus        47 ~~F~CPfC~e~~-D~~~L~~H   66 (191)
                      ..|.||||+... -+..+...
T Consensus         5 ~D~~cP~cy~~~~~l~~~~~~   25 (192)
T cd03022           5 FDFSSPYSYLAHERLPALAAR   25 (192)
T ss_pred             EeCCChHHHHHHHHHHHHHHH
Confidence            679999999943 33445543


No 183
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=23.66  E-value=30  Score=26.95  Aligned_cols=28  Identities=36%  Similarity=0.699  Sum_probs=19.2

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      ..+.|+-|+..+.....            ....||-|...
T Consensus        70 ~~~~C~~Cg~~~~~~~~------------~~~~CP~Cgs~   97 (117)
T PRK00564         70 VELECKDCSHVFKPNAL------------DYGVCEKCHSK   97 (117)
T ss_pred             CEEEhhhCCCccccCCc------------cCCcCcCCCCC
Confidence            57999999976655422            22459999763


No 184
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=23.62  E-value=36  Score=21.30  Aligned_cols=11  Identities=36%  Similarity=0.812  Sum_probs=5.8

Q ss_pred             cccccccccCc
Q 029557           77 SGVCPVCVTRV   87 (191)
Q Consensus        77 ~vVCPICa~~~   87 (191)
                      .+.||-|..++
T Consensus        17 ~irC~~CG~RI   27 (32)
T PF03604_consen   17 PIRCPECGHRI   27 (32)
T ss_dssp             TSSBSSSS-SE
T ss_pred             cEECCcCCCeE
Confidence            35677775443


No 185
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=23.48  E-value=47  Score=29.73  Aligned_cols=38  Identities=26%  Similarity=0.524  Sum_probs=26.2

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcccchHhh
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDH   94 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~~d~v~H   94 (191)
                      ....||.|+.. +      -+.+   .+...+||.-|-.-+..+++.+
T Consensus        10 ~~~~Cp~Cg~~-~------iv~d---~~~Ge~vC~~CG~Vl~e~~iD~   47 (310)
T PRK00423         10 EKLVCPECGSD-K------LIYD---YERGEIVCADCGLVIEENIIDQ   47 (310)
T ss_pred             cCCcCcCCCCC-C------eeEE---CCCCeEeecccCCccccccccc
Confidence            34679999961 1      1222   2577899999999887777655


No 186
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=23.46  E-value=44  Score=23.67  Aligned_cols=10  Identities=30%  Similarity=1.026  Sum_probs=7.0

Q ss_pred             cCCCCCCCcC
Q 029557           50 PCPFCSEDFD   59 (191)
Q Consensus        50 ~CPfC~e~~D   59 (191)
                      -||+||+.++
T Consensus         5 HC~~CG~~Ip   14 (59)
T PF09889_consen    5 HCPVCGKPIP   14 (59)
T ss_pred             cCCcCCCcCC
Confidence            4888887554


No 187
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=23.40  E-value=34  Score=28.30  Aligned_cols=31  Identities=29%  Similarity=0.709  Sum_probs=18.4

Q ss_pred             cCCCCCCCcCHHHHHhhhhhcCCCCCCc-----ccccccccC
Q 029557           50 PCPFCSEDFDLVGLCCHIDEEHPVEAKS-----GVCPVCVTR   86 (191)
Q Consensus        50 ~CPfC~e~~D~~~L~~H~~eeH~~e~k~-----vVCPICa~~   86 (191)
                      .|||||....      |+.+.-.....+     --||-|.-.
T Consensus         2 ~cp~c~~~~~------~~~~s~~~~~~~~~~~~~~c~~c~~~   37 (154)
T PRK00464          2 RCPFCGHPDT------RVIDSRPAEDGNAIRRRRECLACGKR   37 (154)
T ss_pred             cCCCCCCCCC------EeEeccccCCCCceeeeeeccccCCc
Confidence            6999998431      333444333333     349999764


No 188
>PHA02540 61 DNA primase; Provisional
Probab=23.02  E-value=37  Score=31.42  Aligned_cols=9  Identities=33%  Similarity=1.472  Sum_probs=8.2

Q ss_pred             eecCCCCCC
Q 029557           48 EYPCPFCSE   56 (191)
Q Consensus        48 ~F~CPfC~e   56 (191)
                      .+.||||++
T Consensus        27 ~~~CPf~~d   35 (337)
T PHA02540         27 NFRCPICGD   35 (337)
T ss_pred             EecCCCCCC
Confidence            599999998


No 189
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=22.88  E-value=39  Score=30.71  Aligned_cols=17  Identities=35%  Similarity=0.858  Sum_probs=15.5

Q ss_pred             ccCcceecCCCCCCCcC
Q 029557           43 VKGEYEYPCPFCSEDFD   59 (191)
Q Consensus        43 ~~~~~~F~CPfC~e~~D   59 (191)
                      +||..+|.||-|+..|.
T Consensus       150 mwG~aef~C~~C~h~F~  166 (278)
T PF15135_consen  150 MWGIAEFHCPKCRHNFR  166 (278)
T ss_pred             ccceeeeecccccccch
Confidence            88899999999998776


No 190
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=22.57  E-value=50  Score=20.96  Aligned_cols=20  Identities=30%  Similarity=0.642  Sum_probs=12.1

Q ss_pred             HHhhhhhcCCCCCCcccccccc
Q 029557           63 LCCHIDEEHPVEAKSGVCPVCV   84 (191)
Q Consensus        63 L~~H~~eeH~~e~k~vVCPICa   84 (191)
                      +|.-+.....  .+.++||+|.
T Consensus        24 ~C~~C~~~~~--~~~~~CP~C~   43 (44)
T PF14634_consen   24 FCEKCLKKLK--GKSVKCPICR   43 (44)
T ss_pred             HHHHHHHhhc--CCCCCCcCCC
Confidence            3344444443  6678999994


No 191
>COG2761 FrnE Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=22.30  E-value=29  Score=30.55  Aligned_cols=53  Identities=19%  Similarity=0.271  Sum_probs=33.7

Q ss_pred             ccCcceecCCCCCC-CcCHHHHHhhhh-------hcCCCCCCcccccccccCcccchHhhhhcccccc
Q 029557           43 VKGEYEYPCPFCSE-DFDLVGLCCHID-------EEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNI  102 (191)
Q Consensus        43 ~~~~~~F~CPfC~e-~~D~~~L~~H~~-------eeH~~e~k~vVCPICa~~~~~d~v~Hl~~qH~~~  102 (191)
                      ++  ..+.||+|+. .-.+..+..-..       .-|+++.....||-     +.|...++...-|..
T Consensus        10 v~--sD~vCPwC~ig~~rL~ka~~~~~~~~~v~i~w~pf~l~p~~~~~-----g~~~~~~l~~k~g~~   70 (225)
T COG2761          10 VF--SDVVCPWCYIGKRRLEKALAEYPQEVRVEIRWRPFELDPDLPPE-----GLDRKEYLAQKYGIS   70 (225)
T ss_pred             EE--eCCcCchhhcCHHHHHHHHHhcCcceeEEEEecccccCCCCCcc-----cccHHHHHHHHhCcc
Confidence            56  7899999998 555555444333       34667777777775     566666665444443


No 192
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=22.03  E-value=41  Score=27.85  Aligned_cols=10  Identities=40%  Similarity=0.823  Sum_probs=8.1

Q ss_pred             Cccccccccc
Q 029557           76 KSGVCPVCVT   85 (191)
Q Consensus        76 k~vVCPICa~   85 (191)
                      +.+.||+|-.
T Consensus        31 glv~CP~Cgs   40 (148)
T PF06676_consen   31 GLVSCPVCGS   40 (148)
T ss_pred             CCccCCCCCC
Confidence            5688999965


No 193
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=21.97  E-value=38  Score=22.18  Aligned_cols=8  Identities=50%  Similarity=1.447  Sum_probs=3.6

Q ss_pred             ecCCCCCC
Q 029557           49 YPCPFCSE   56 (191)
Q Consensus        49 F~CPfC~e   56 (191)
                      =+||.|+-
T Consensus         4 ~pCP~CGG   11 (40)
T PF08273_consen    4 GPCPICGG   11 (40)
T ss_dssp             E--TTTT-
T ss_pred             CCCCCCcC
Confidence            36888875


No 194
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=21.93  E-value=44  Score=23.56  Aligned_cols=9  Identities=56%  Similarity=1.431  Sum_probs=8.0

Q ss_pred             eecCCCCCC
Q 029557           48 EYPCPFCSE   56 (191)
Q Consensus        48 ~F~CPfC~e   56 (191)
                      ..+||||+.
T Consensus        35 ~~pC~fCg~   43 (57)
T PF06221_consen   35 LGPCPFCGT   43 (57)
T ss_pred             cCcCCCCCC
Confidence            579999998


No 195
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=21.90  E-value=30  Score=27.25  Aligned_cols=8  Identities=38%  Similarity=1.281  Sum_probs=5.1

Q ss_pred             ecCCCCCC
Q 029557           49 YPCPFCSE   56 (191)
Q Consensus        49 F~CPfC~e   56 (191)
                      |.||.||-
T Consensus        93 ~~CP~Cgs  100 (124)
T PRK00762         93 IECPVCGN  100 (124)
T ss_pred             CcCcCCCC
Confidence            56777764


No 196
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=21.85  E-value=66  Score=27.26  Aligned_cols=39  Identities=18%  Similarity=0.265  Sum_probs=25.5

Q ss_pred             cCCCCCC---CcCHHHHHhhhhhcCCCC-CCcccccccccCcc
Q 029557           50 PCPFCSE---DFDLVGLCCHIDEEHPVE-AKSGVCPVCVTRVT   88 (191)
Q Consensus        50 ~CPfC~e---~~D~~~L~~H~~eeH~~e-~k~vVCPICa~~~~   88 (191)
                      .||+|+.   .+.-.+-..-+...|... ...-+||.|-..-|
T Consensus        99 RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~CgkiYW  141 (165)
T COG1656          99 RCPECNGELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKIYW  141 (165)
T ss_pred             cCcccCCEeccCcHHHHhhccchhhhhcccceeECCCCccccc
Confidence            5999998   445555554555555543 33467999988766


No 197
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type. The N-terminal region of about 200 amino acids is rich in low-complexity sequence, poorly alignable, and not included n this model.
Probab=21.60  E-value=57  Score=35.07  Aligned_cols=47  Identities=19%  Similarity=0.386  Sum_probs=31.0

Q ss_pred             ccCCCCCCCcchhhhccCcceecCCCCCC-CcCHHHHHhhhhhcCCCCCCcccccccccC
Q 029557           28 FCIDFEDIEEDDYEEVKGEYEYPCPFCSE-DFDLVGLCCHIDEEHPVEAKSGVCPVCVTR   86 (191)
Q Consensus        28 ~~~g~e~~e~d~d~e~~~~~~F~CPfC~e-~~D~~~L~~H~~eeH~~e~k~vVCPICa~~   86 (191)
                      |.+|+-|++   +  ++  +-|.||-|.- +|...+-     -.--++--.-.||.|-..
T Consensus       670 y~lgITeVd---P--L~--phy~c~~c~~~ef~~~~~-----~~sg~dlp~k~cp~c~~~  717 (1213)
T TIGR01405       670 TMTGITEVN---P--LP--PHYLCPNCKYSEFITDGS-----VGSGFDLPDKDCPKCGAP  717 (1213)
T ss_pred             HHhcCCCcC---C--Cc--ccccCccccccccccccc-----ccccccCccccCcccccc
Confidence            466776654   4  77  8899999987 7754431     111234455689999875


No 198
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=21.01  E-value=25  Score=22.36  Aligned_cols=10  Identities=30%  Similarity=1.092  Sum_probs=5.5

Q ss_pred             CCCCCCCcCH
Q 029557           51 CPFCSEDFDL   60 (191)
Q Consensus        51 CPfC~e~~D~   60 (191)
                      ||-|+..+..
T Consensus         2 CP~C~~~l~~   11 (41)
T PF13453_consen    2 CPRCGTELEP   11 (41)
T ss_pred             cCCCCcccce
Confidence            6666554443


No 199
>PRK11639 zinc uptake transcriptional repressor; Provisional
Probab=20.75  E-value=72  Score=26.06  Aligned_cols=41  Identities=15%  Similarity=0.360  Sum_probs=28.7

Q ss_pred             ceecCCCCCC--CcCH---HHHHhhhhhcCCCCCC------cccccccccCc
Q 029557           47 YEYPCPFCSE--DFDL---VGLCCHIDEEHPVEAK------SGVCPVCVTRV   87 (191)
Q Consensus        47 ~~F~CPfC~e--~~D~---~~L~~H~~eeH~~e~k------~vVCPICa~~~   87 (191)
                      .-|.|=-||.  +|+.   ..+...+...|.+...      .++||-|....
T Consensus        99 ~H~iC~~CGki~~i~~~~l~~~~~~~~~~~gf~i~~~~l~~~GiC~~C~~~~  150 (169)
T PRK11639         99 AMFICDRCGAVKEECAEGVEDIMHTLAAKMGFALRHNVIEAHGLCAACVEVE  150 (169)
T ss_pred             CeEEeCCCCCEEEecccHHHHHHHHHHHHcCCEEeccEEEEEEEChhhcCcc
Confidence            3599999999  7763   3456667677766433      37899997763


No 200
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=20.36  E-value=68  Score=26.91  Aligned_cols=35  Identities=23%  Similarity=0.508  Sum_probs=24.0

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCc
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRV   87 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~   87 (191)
                      ...|.-|+..+....+..++.     +...-.||.|...+
T Consensus       109 ~~~C~~C~~~~~~~~~~~~~~-----~~~~p~C~~Cg~~l  143 (218)
T cd01407         109 RVRCTKCGKEYPRDELQADID-----REEVPRCPKCGGLL  143 (218)
T ss_pred             cceeCCCcCCCcHHHHhHhhc-----cCCCCcCCCCCCcc
Confidence            688999999887776653332     23345799997653


No 201
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=20.28  E-value=71  Score=30.69  Aligned_cols=56  Identities=20%  Similarity=0.290  Sum_probs=35.2

Q ss_pred             eecCCC--CCC-CcCHHHHHhhhhhcC-CCCCCccccccccc--CcccchHhhhhcccccch
Q 029557           48 EYPCPF--CSE-DFDLVGLCCHIDEEH-PVEAKSGVCPVCVT--RVTMDMVDHITTQHGNIS  103 (191)
Q Consensus        48 ~F~CPf--C~e-~~D~~~L~~H~~eeH-~~e~k~vVCPICa~--~~~~d~v~Hl~~qH~~~~  103 (191)
                      -|.|-+  |-+ -=....|..|..+.| .+.+-.-.|-+|..  .-|.++.+||+-+||.-+
T Consensus       319 ~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f~~  380 (467)
T KOG3608|consen  319 VYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGFRL  380 (467)
T ss_pred             ceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhcccC
Confidence            355655  555 223445566666666 33344456777765  346799999999998754


No 202
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins.
Probab=20.26  E-value=41  Score=23.07  Aligned_cols=28  Identities=29%  Similarity=0.595  Sum_probs=21.4

Q ss_pred             CCCcccccccccCcccchHhhhh-cccccc
Q 029557           74 EAKSGVCPVCVTRVTMDMVDHIT-TQHGNI  102 (191)
Q Consensus        74 e~k~vVCPICa~~~~~d~v~Hl~-~qH~~~  102 (191)
                      +++.+.|-+|..+- .||..||. -+|+.+
T Consensus         2 ~~k~GYCE~Cr~kf-d~l~~Hi~s~~Hr~F   30 (49)
T smart00586        2 EKKPGYCENCREKY-DDLETHLLSEKHRRF   30 (49)
T ss_pred             CCCCcccccHhHHH-hhHHHHhccHHHHHH
Confidence            67899999998876 58999995 344444


No 203
>KOG3214 consensus Uncharacterized Zn ribbon-containing protein [Function unknown]
Probab=20.22  E-value=43  Score=26.59  Aligned_cols=34  Identities=24%  Similarity=0.802  Sum_probs=18.8

Q ss_pred             ceecCCCCCCCcCHHHHHhhhhhcCCCCCCccccccccc
Q 029557           47 YEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVT   85 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~   85 (191)
                      ..|.||||.-+-   ..-+-++..|.  ...+-|-||..
T Consensus        22 t~FnClfcnHek---~v~~~~Dk~~~--iG~~sC~iC~e   55 (109)
T KOG3214|consen   22 TQFNCLFCNHEK---SVSCTLDKKHN--IGKASCRICEE   55 (109)
T ss_pred             eeeccCcccccc---ceeeeehhhcC--cceeeeeehhh
Confidence            459999997632   11111222222  23467999965


No 204
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=20.21  E-value=43  Score=27.84  Aligned_cols=32  Identities=31%  Similarity=0.667  Sum_probs=18.7

Q ss_pred             cCCCCCC-CcCHHHHHhhhhhcCCCCCCc-----ccccccccCcc
Q 029557           50 PCPFCSE-DFDLVGLCCHIDEEHPVEAKS-----GVCPVCVTRVT   88 (191)
Q Consensus        50 ~CPfC~e-~~D~~~L~~H~~eeH~~e~k~-----vVCPICa~~~~   88 (191)
                      .||||+. +--       +.+.-..+..+     =-|+.|..+-+
T Consensus         2 ~CP~C~~~dtk-------ViDSR~~~dg~~IRRRReC~~C~~RFT   39 (147)
T TIGR00244         2 HCPFCQHHNTR-------VLDSRLVEDGQSIRRRRECLECHERFT   39 (147)
T ss_pred             CCCCCCCCCCE-------eeeccccCCCCeeeecccCCccCCccc
Confidence            5999998 432       22333333333     34999988643


No 205
>PF14968 CCDC84:  Coiled coil protein 84
Probab=20.16  E-value=44  Score=31.09  Aligned_cols=22  Identities=23%  Similarity=0.490  Sum_probs=16.1

Q ss_pred             ceecCCCCCCCcCHH-------HHHhhhh
Q 029557           47 YEYPCPFCSEDFDLV-------GLCCHID   68 (191)
Q Consensus        47 ~~F~CPfC~e~~D~~-------~L~~H~~   68 (191)
                      ..|=|+||+.++...       ++..|+-
T Consensus        57 ~~fWC~fC~~ev~~~~s~~~~~~ai~HLa   85 (336)
T PF14968_consen   57 NRFWCVFCDCEVREHDSSFACGGAIEHLA   85 (336)
T ss_pred             ceeEeeCccchhhhccchhhhccHHhhcC
Confidence            679999999877654       5555553


No 206
>KOG4080 consensus Mitochondrial ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=20.15  E-value=44  Score=28.59  Aligned_cols=25  Identities=28%  Similarity=0.752  Sum_probs=17.0

Q ss_pred             eecCCCCCCCcCHHHHHhhhhhcCCCCCCcccccccccCcc
Q 029557           48 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVT   88 (191)
Q Consensus        48 ~F~CPfC~e~~D~~~L~~H~~eeH~~e~k~vVCPICa~~~~   88 (191)
                      .=+||-||-          +.      ...+.|+-|..+|-
T Consensus        93 l~~CP~CGh----------~k------~a~~LC~~Cy~kV~  117 (176)
T KOG4080|consen   93 LNTCPACGH----------IK------PAHTLCDYCYAKVH  117 (176)
T ss_pred             cccCcccCc----------cc------cccccHHHHHHHHH
Confidence            458999984          22      23478899988764


Done!