BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029573
         (191 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4ACQ|A Chain A, Alpha-2 Macroglobulin
 pdb|4ACQ|B Chain B, Alpha-2 Macroglobulin
 pdb|4ACQ|C Chain C, Alpha-2 Macroglobulin
 pdb|4ACQ|D Chain D, Alpha-2 Macroglobulin
          Length = 1451

 Score = 28.5 bits (62), Expect = 2.3,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 1   MAEKDDLGLSLSLSFPQNHHSLQLNLMPSSACS 33
           +A K DL  S S S P +H  L++   P S C+
Sbjct: 541 LANKVDLSFSPSQSLPASHAHLRVTAAPQSVCA 573


>pdb|3KV5|D Chain D, Structure Of Kiaa1718, Human Jumonji Demethylase, In
           Complex With N-Oxalylglycine
 pdb|3KV5|A Chain A, Structure Of Kiaa1718, Human Jumonji Demethylase, In
           Complex With N-Oxalylglycine
 pdb|3KV6|A Chain A, Structure Of Kiaa1718, Human Jumonji Demethylase, In
           Complex With Alpha-Ketoglutarate
 pdb|3KV6|D Chain D, Structure Of Kiaa1718, Human Jumonji Demethylase, In
           Complex With Alpha-Ketoglutarate
          Length = 488

 Score = 26.9 bits (58), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 3/65 (4%)

Query: 17  QNHHSLQLNLMPSSACSTSPSGFSLQKTP--WNEALFPSSDPNSESCRAETRSFLRGIDV 74
           + HH++ ++L     C+    G SL K    W+   +   D  S+  +A TR+F++ +  
Sbjct: 70  EEHHAVDIDLYHCPNCAVL-HGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRS 128

Query: 75  NRLPS 79
              PS
Sbjct: 129 RVFPS 133


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.127    0.359 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,504,332
Number of Sequences: 62578
Number of extensions: 148050
Number of successful extensions: 172
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 171
Number of HSP's gapped (non-prelim): 2
length of query: 191
length of database: 14,973,337
effective HSP length: 93
effective length of query: 98
effective length of database: 9,153,583
effective search space: 897051134
effective search space used: 897051134
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 48 (23.1 bits)