BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 029573
(191 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4ACQ|A Chain A, Alpha-2 Macroglobulin
pdb|4ACQ|B Chain B, Alpha-2 Macroglobulin
pdb|4ACQ|C Chain C, Alpha-2 Macroglobulin
pdb|4ACQ|D Chain D, Alpha-2 Macroglobulin
Length = 1451
Score = 28.5 bits (62), Expect = 2.3, Method: Composition-based stats.
Identities = 13/33 (39%), Positives = 18/33 (54%)
Query: 1 MAEKDDLGLSLSLSFPQNHHSLQLNLMPSSACS 33
+A K DL S S S P +H L++ P S C+
Sbjct: 541 LANKVDLSFSPSQSLPASHAHLRVTAAPQSVCA 573
>pdb|3KV5|D Chain D, Structure Of Kiaa1718, Human Jumonji Demethylase, In
Complex With N-Oxalylglycine
pdb|3KV5|A Chain A, Structure Of Kiaa1718, Human Jumonji Demethylase, In
Complex With N-Oxalylglycine
pdb|3KV6|A Chain A, Structure Of Kiaa1718, Human Jumonji Demethylase, In
Complex With Alpha-Ketoglutarate
pdb|3KV6|D Chain D, Structure Of Kiaa1718, Human Jumonji Demethylase, In
Complex With Alpha-Ketoglutarate
Length = 488
Score = 26.9 bits (58), Expect = 7.1, Method: Compositional matrix adjust.
Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 3/65 (4%)
Query: 17 QNHHSLQLNLMPSSACSTSPSGFSLQKTP--WNEALFPSSDPNSESCRAETRSFLRGIDV 74
+ HH++ ++L C+ G SL K W+ + D S+ +A TR+F++ +
Sbjct: 70 EEHHAVDIDLYHCPNCAVL-HGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRS 128
Query: 75 NRLPS 79
PS
Sbjct: 129 RVFPS 133
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.310 0.127 0.359
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,504,332
Number of Sequences: 62578
Number of extensions: 148050
Number of successful extensions: 172
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 171
Number of HSP's gapped (non-prelim): 2
length of query: 191
length of database: 14,973,337
effective HSP length: 93
effective length of query: 98
effective length of database: 9,153,583
effective search space: 897051134
effective search space used: 897051134
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 48 (23.1 bits)