BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 029597
(191 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|P38274|HSL7_YEAST Protein arginine N-methyltransferase HSL7 OS=Saccharomyces
cerevisiae (strain ATCC 204508 / S288c) GN=HSL7 PE=1
SV=1
Length = 827
Score = 30.8 bits (68), Expect = 6.2, Method: Composition-based stats.
Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 8/72 (11%)
Query: 47 ISTLFTDLRISSADSTANPRSFPYSVKQQ--CWEKAEKVRGRDPDRWR------KDALGN 98
IS LF D ++S NP+++ Y K+ CW+ K+ D +W+ K +
Sbjct: 399 ISMLFMDSKVSIIAIEKNPQAYLYLQKRNFDCWDNRVKLIKEDMTKWQINEPSEKRIQID 458
Query: 99 VVFRKLVGCPGC 110
+ +L+G GC
Sbjct: 459 LCISELLGSFGC 470
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.315 0.130 0.388
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 69,711,249
Number of Sequences: 539616
Number of extensions: 2662816
Number of successful extensions: 7252
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 7238
Number of HSP's gapped (non-prelim): 18
length of query: 191
length of database: 191,569,459
effective HSP length: 111
effective length of query: 80
effective length of database: 131,672,083
effective search space: 10533766640
effective search space used: 10533766640
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 58 (26.9 bits)