BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029597
         (191 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|P38274|HSL7_YEAST Protein arginine N-methyltransferase HSL7 OS=Saccharomyces
           cerevisiae (strain ATCC 204508 / S288c) GN=HSL7 PE=1
           SV=1
          Length = 827

 Score = 30.8 bits (68), Expect = 6.2,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 8/72 (11%)

Query: 47  ISTLFTDLRISSADSTANPRSFPYSVKQQ--CWEKAEKVRGRDPDRWR------KDALGN 98
           IS LF D ++S      NP+++ Y  K+   CW+   K+   D  +W+      K    +
Sbjct: 399 ISMLFMDSKVSIIAIEKNPQAYLYLQKRNFDCWDNRVKLIKEDMTKWQINEPSEKRIQID 458

Query: 99  VVFRKLVGCPGC 110
           +   +L+G  GC
Sbjct: 459 LCISELLGSFGC 470


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.315    0.130    0.388 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 69,711,249
Number of Sequences: 539616
Number of extensions: 2662816
Number of successful extensions: 7252
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 7238
Number of HSP's gapped (non-prelim): 18
length of query: 191
length of database: 191,569,459
effective HSP length: 111
effective length of query: 80
effective length of database: 131,672,083
effective search space: 10533766640
effective search space used: 10533766640
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 58 (26.9 bits)