Citrus Sinensis ID: 029620
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 190 | ||||||
| 225458701 | 467 | PREDICTED: cysteine proteinase RD21a-lik | 0.989 | 0.402 | 0.819 | 1e-81 | |
| 147790682 | 469 | hypothetical protein VITISV_001146 [Viti | 0.989 | 0.400 | 0.819 | 1e-81 | |
| 302142276 | 388 | unnamed protein product [Vitis vinifera] | 0.989 | 0.484 | 0.819 | 7e-81 | |
| 109390302 | 457 | cysteine protease [Hevea brasiliensis] | 0.978 | 0.407 | 0.807 | 5e-79 | |
| 255538210 | 469 | cysteine protease, putative [Ricinus com | 0.984 | 0.398 | 0.787 | 6e-79 | |
| 118486542 | 465 | unknown [Populus trichocarpa] | 0.984 | 0.402 | 0.797 | 2e-78 | |
| 224136808 | 456 | predicted protein [Populus trichocarpa] | 0.984 | 0.410 | 0.797 | 2e-78 | |
| 146216004 | 461 | cysteine protease Cp6 [Actinidia delicio | 0.989 | 0.407 | 0.805 | 2e-78 | |
| 374713651 | 467 | cysteine protease [Carica papaya] | 0.994 | 0.404 | 0.783 | 2e-77 | |
| 148927394 | 469 | cysteine proteinase [Elaeis guineensis] | 0.989 | 0.400 | 0.805 | 3e-77 |
| >gi|225458701|ref|XP_002284973.1| PREDICTED: cysteine proteinase RD21a-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 307 bits (787), Expect = 1e-81, Method: Compositional matrix adjust.
Identities = 154/188 (81%), Positives = 171/188 (90%)
Query: 3 FQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGT 62
FQLY+SGIFTGRCGT+LDHGVTAVGYGTENG DYWIVKNSWG+SWGE GYIRMER++A +
Sbjct: 280 FQLYQSGIFTGRCGTALDHGVTAVGYGTENGVDYWIVKNSWGASWGEEGYIRMERDLATS 339
Query: 63 LTGKCGIAMEASYPIKKGQNPPNPGPSPPSPTKPPAVCDNYYSCPESNTCCCVFEYGNSC 122
TGKCGIAMEASYPIKKGQNPPNPGPSPPSP KPP VCDNYY+CPES+TCCC+FEY C
Sbjct: 340 ATGKCGIAMEASYPIKKGQNPPNPGPSPPSPIKPPTVCDNYYACPESSTCCCIFEYAKYC 399
Query: 123 FAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYWAHG 182
F WGCCPLEAATCC+DH SCCP +YP+CNVRAGTC+MSKDNPLGV+AL+RT AKP+WA+G
Sbjct: 400 FQWGCCPLEAATCCEDHDSCCPQEYPVCNVRAGTCMMSKDNPLGVKALKRTAAKPHWAYG 459
Query: 183 NQGGSSSA 190
G SSA
Sbjct: 460 GDGKRSSA 467
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147790682|emb|CAN61026.1| hypothetical protein VITISV_001146 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302142276|emb|CBI19479.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|109390302|gb|ABG33750.1| cysteine protease [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
| >gi|255538210|ref|XP_002510170.1| cysteine protease, putative [Ricinus communis] gi|223550871|gb|EEF52357.1| cysteine protease, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|118486542|gb|ABK95110.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224136808|ref|XP_002326950.1| predicted protein [Populus trichocarpa] gi|222835265|gb|EEE73700.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|146216004|gb|ABQ10204.1| cysteine protease Cp6 [Actinidia deliciosa] | Back alignment and taxonomy information |
|---|
| >gi|374713651|gb|AEZ65083.1| cysteine protease [Carica papaya] | Back alignment and taxonomy information |
|---|
| >gi|148927394|gb|ABR19828.1| cysteine proteinase [Elaeis guineensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 190 | ||||||
| TAIR|locus:2825832 | 462 | RD21A "responsive to dehydrati | 0.447 | 0.183 | 0.694 | 7.7e-70 | |
| TAIR|locus:2167821 | 463 | RD21B "esponsive to dehydratio | 0.936 | 0.384 | 0.636 | 8.2e-67 | |
| TAIR|locus:2090614 | 452 | AT3G19390 [Arabidopsis thalian | 0.884 | 0.371 | 0.545 | 6.1e-55 | |
| TAIR|locus:2024362 | 437 | XBCP3 "xylem bark cysteine pep | 0.857 | 0.372 | 0.449 | 4.8e-39 | |
| TAIR|locus:2128253 | 371 | AT4G11320 [Arabidopsis thalian | 0.378 | 0.194 | 0.712 | 1.8e-25 | |
| TAIR|locus:2038515 | 343 | AT1G06260 [Arabidopsis thalian | 0.378 | 0.209 | 0.712 | 4.6e-25 | |
| TAIR|locus:2128243 | 364 | AT4G11310 [Arabidopsis thalian | 0.378 | 0.197 | 0.698 | 4.6e-25 | |
| TAIR|locus:2090629 | 362 | AT3G19400 [Arabidopsis thalian | 0.384 | 0.201 | 0.608 | 6.8e-24 | |
| TAIR|locus:505006391 | 364 | CEP3 "cysteine endopeptidase 3 | 0.378 | 0.197 | 0.635 | 1.4e-23 | |
| TAIR|locus:2157712 | 361 | CEP1 "cysteine endopeptidase 1 | 0.378 | 0.199 | 0.662 | 1.8e-23 |
| TAIR|locus:2825832 RD21A "responsive to dehydration 21A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 405 (147.6 bits), Expect = 7.7e-70, Sum P(2) = 7.7e-70
Identities = 59/85 (69%), Positives = 75/85 (88%)
Query: 100 CDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLM 159
CD+YY+CPESNTCCC+FEYG CFAWGCCPLEAATCCDD+YSCCPH+YP+C++ GTCL+
Sbjct: 375 CDSYYTCPESNTCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLL 434
Query: 160 SKDNPLGVRALRRTPAKPYWAHGNQ 184
SK++P V+AL+R PA P+W+ G +
Sbjct: 435 SKNSPFSVKALKRKPATPFWSQGRK 459
|
|
| TAIR|locus:2167821 RD21B "esponsive to dehydration 21B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090614 AT3G19390 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024362 XBCP3 "xylem bark cysteine peptidase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2128253 AT4G11320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2038515 AT1G06260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2128243 AT4G11310 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090629 AT3G19400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006391 CEP3 "cysteine endopeptidase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157712 CEP1 "cysteine endopeptidase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 190 | |||
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 3e-37 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 1e-32 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 2e-27 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 2e-22 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 1e-19 | |
| smart00277 | 51 | smart00277, GRAN, Granulin | 6e-16 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 4e-13 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 2e-12 | |
| pfam00396 | 43 | pfam00396, Granulin, Granulin | 6e-12 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 1e-10 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 3e-10 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 1e-09 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 4e-07 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 9e-07 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 6e-05 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 2e-04 |
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
Score = 128 bits (323), Expect = 3e-37
Identities = 46/78 (58%), Positives = 52/78 (66%), Gaps = 6/78 (7%)
Query: 1 MAFQLYESGIFTG-RCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNV 59
FQLY+SG++ C LDH V VGYGTENG YWIVKNSWG+ WGE GY R+ R V
Sbjct: 141 DDFQLYKSGVYKHTECSGELDHAVLIVGYGTENGVPYWIVKNSWGTDWGENGYFRIARGV 200
Query: 60 AGTLTGKCGIAMEASYPI 77
+CGIA EASYPI
Sbjct: 201 -----NECGIASEASYPI 213
|
Length = 213 |
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197621 smart00277, GRAN, Granulin | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|215898 pfam00396, Granulin, Granulin | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 190 | |||
| KOG4296 | 90 | consensus Epithelin/granulin [Signal transduction | 99.95 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 99.91 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 99.9 | |
| PTZ00203 | 348 | cathepsin L protease; Provisional | 99.9 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 99.9 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 99.9 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 99.9 | |
| KOG1543 | 325 | consensus Cysteine proteinase Cathepsin L [Posttra | 99.89 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 99.88 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 99.87 | |
| KOG1542 | 372 | consensus Cysteine proteinase Cathepsin F [Posttra | 99.87 | |
| smart00277 | 51 | GRAN Granulin. | 99.87 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 99.86 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 99.83 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 99.82 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 99.76 | |
| PF00396 | 43 | Granulin: Granulin; InterPro: IPR000118 Metazoan g | 99.74 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 99.68 | |
| KOG1544 | 470 | consensus Predicted cysteine proteinase TIN-ag [Ge | 99.58 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.47 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.11 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 98.58 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 97.07 | |
| KOG4128 | 457 | consensus Bleomycin hydrolases and aminopeptidases | 84.32 |
| >KOG4296 consensus Epithelin/granulin [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=99.95 E-value=7.4e-29 Score=180.80 Aligned_cols=82 Identities=52% Similarity=1.423 Sum_probs=79.2
Q ss_pred CCCCcccCCCCcccccccCCCcccccccccCCCceecCCCCccCCCCCCcccCCCCeeeCCCCCCccccchhccCCcccc
Q 029620 100 CDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYW 179 (190)
Q Consensus 100 Cd~~~~Cp~~~TCC~~~~~~~~c~~~gCCp~~~avCC~D~~hCCP~g~~~C~~~~~~C~~~~~~~~~~~~~~k~pa~~~~ 179 (190)
||.+++||+++|||++.+.+++|.+|||||+++||||+|+.|||||+||+||+.+++|++..++++.|+.|+|.||+..+
T Consensus 1 Cd~~~~Cp~~~TCCcl~e~~~~cfsWgCCp~e~A~CCdD~~hCCPh~ypVCD~~~~~Cl~k~ns~~sikal~kkpA~~~~ 80 (90)
T KOG4296|consen 1 CDSYTECPDSETCCCLYEYGGYCFSWGCCPMESAVCCDDRSHCCPHGYPVCDLQRSTCLMKKNSPTSIKALKKKPAIKTL 80 (90)
T ss_pred CCcceecCCCCceEEeeecCceeceeccccCCcceeecCCCccCCCCCcccccccceeeccCCCcccchhhccCCccccc
Confidence 78999999999999999999999999999999999999999999999999999999999999999999999999999887
Q ss_pred cc
Q 029620 180 AH 181 (190)
Q Consensus 180 ~~ 181 (190)
..
T Consensus 81 ~~ 82 (90)
T KOG4296|consen 81 ER 82 (90)
T ss_pred cc
Confidence 64
|
|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >KOG1543 consensus Cysteine proteinase Cathepsin L [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >KOG1542 consensus Cysteine proteinase Cathepsin F [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00277 GRAN Granulin | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >PF00396 Granulin: Granulin; InterPro: IPR000118 Metazoan granulins [] are a family of cysteine-rich peptides of about 6 Kd which may have multiple biological activity | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >KOG1544 consensus Predicted cysteine proteinase TIN-ag [General function prediction only] | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4128 consensus Bleomycin hydrolases and aminopeptidases of cysteine protease family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 190 | ||||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 2e-24 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 2e-24 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 1e-22 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 3e-22 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 3e-22 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 4e-22 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 1e-21 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 4e-21 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 9e-20 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 3e-16 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 7e-16 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 8e-16 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 1e-15 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 2e-15 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 3e-15 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 3e-15 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 4e-14 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 6e-14 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 7e-14 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 7e-14 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 7e-14 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 7e-14 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 7e-14 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 8e-14 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 8e-14 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 8e-14 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 8e-14 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 9e-14 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 9e-14 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 9e-14 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 9e-14 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 9e-14 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 9e-14 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 9e-14 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 9e-14 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 1e-13 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 1e-13 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 1e-13 | ||
| 1ppo_A | 216 | Determination Of The Structure Of Papaya Protease O | 2e-13 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 5e-13 | ||
| 1meg_A | 216 | Crystal Structure Of A Caricain D158e Mutant In Com | 5e-13 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 1e-12 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 2e-12 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 2e-12 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 2e-12 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 2e-12 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 3e-12 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 3e-12 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 4e-12 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 4e-12 | ||
| 1pci_A | 322 | Procaricain Length = 322 | 4e-12 | ||
| 1gec_E | 216 | Glycyl Endopeptidase-complex With Benzyloxycarbonyl | 4e-12 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 6e-12 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 6e-12 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 1e-11 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 6e-11 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 9e-11 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 2e-10 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 3e-10 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 3e-10 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 3e-10 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 3e-10 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 3e-10 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 3e-10 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 3e-10 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 3e-10 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 3e-10 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 5e-10 | ||
| 3bpm_A | 243 | Crystal Structure Of Falcipain-3 With Its Inhibitor | 8e-10 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 8e-10 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 1e-09 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 2e-09 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 2e-09 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 4e-09 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 4e-09 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 6e-09 | ||
| 1k3b_C | 69 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 1e-08 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 1e-08 | ||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 3e-08 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 3e-08 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 3e-08 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 4e-08 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 4e-08 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 4e-08 | ||
| 1qdq_A | 253 | X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 | 4e-08 | ||
| 1ito_A | 256 | Crystal Structure Analysis Of Bovine Spleen Catheps | 6e-08 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 6e-08 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 1e-07 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 1e-07 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 1e-07 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 2e-07 | ||
| 1deu_A | 277 | Crystal Structure Of Human Procathepsin X: A Cystei | 3e-07 | ||
| 1ef7_A | 242 | Crystal Structure Of Human Cathepsin X Length = 242 | 4e-07 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 5e-07 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 6e-07 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 6e-07 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 6e-07 | ||
| 2jyt_A | 69 | Human Granulin C, Isomer 1 Length = 69 | 2e-06 | ||
| 2jye_A | 72 | Human Granulin A Length = 72 | 2e-06 | ||
| 1xkg_A | 312 | Crystal Structure Of The Major House Dust Mite Alle | 3e-06 | ||
| 2as8_A | 222 | Crystal Structure Of Mature And Fully Active Der P | 4e-06 | ||
| 3rvw_A | 222 | Crystal Structure Of Der P 1 Complexed With Fab 4c1 | 4e-06 | ||
| 3f5v_A | 222 | C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 | 4e-06 | ||
| 2jyv_A | 72 | Human Granulin F Length = 72 | 5e-05 | ||
| 3ch2_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 5e-05 | ||
| 2wbf_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 5e-05 | ||
| 1icf_B | 42 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 1e-04 |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
|
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|1PCI|A Chain A, Procaricain Length = 322 | Back alignment and structure |
| >pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 | Back alignment and structure |
| >pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 | Back alignment and structure |
| >pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|2JYT|A Chain A, Human Granulin C, Isomer 1 Length = 69 | Back alignment and structure |
| >pdb|2JYE|A Chain A, Human Granulin A Length = 72 | Back alignment and structure |
| >pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 | Back alignment and structure |
| >pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 | Back alignment and structure |
| >pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 | Back alignment and structure |
| >pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 | Back alignment and structure |
| >pdb|2JYV|A Chain A, Human Granulin F Length = 72 | Back alignment and structure |
| >pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 | Back alignment and structure |
| >pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 | Back alignment and structure |
| >pdb|1ICF|B Chain B, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 42 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 190 | |||
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 9e-50 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 2e-48 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 3e-48 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 2e-47 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 2e-46 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 2e-46 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 2e-46 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 2e-46 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 2e-46 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 1e-45 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 1e-45 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 2e-45 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 4e-45 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 5e-45 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 8e-45 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 1e-43 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 3e-43 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 5e-42 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 6e-42 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 2e-41 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 4e-41 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 4e-41 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 1e-40 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 2e-40 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 6e-40 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 9e-40 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 5e-39 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 4e-37 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 2e-36 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 9e-36 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 7e-35 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 1e-33 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 2e-33 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 7e-33 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 1e-32 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 2e-31 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 2e-31 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 2e-29 | |
| 2jye_A | 72 | Granulin A; epithelin, human, stack of hairpins, a | 2e-21 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 2e-20 | |
| 2jyv_A | 72 | Granulin-2, granulin F; granulin C, epithelin, hum | 2e-18 | |
| 2jyt_A | 69 | Granulin-5, granulin C; epithelin, human, stack of | 2e-18 | |
| 1fwo_A | 35 | Oryzain beta chain; beta-hairpin stack fold, granu | 7e-13 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 3e-08 |
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
Score = 159 bits (404), Expect = 9e-50
Identities = 41/77 (53%), Positives = 52/77 (67%), Gaps = 1/77 (1%)
Query: 2 AFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAG 61
FQLY+ GIF G CGT +DH VTAVGYG G Y ++KNSWG++WGE GYIR++R
Sbjct: 140 PFQLYKGGIFEGPCGTKVDHAVTAVGYGKSGGKGYILIKNSWGTAWGEKGYIRIKRAPGN 199
Query: 62 TLTGKCGIAMEASYPIK 78
+ G CG+ + YP K
Sbjct: 200 S-PGVCGLYKSSYYPTK 215
|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >2jye_A Granulin A; epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >2jyv_A Granulin-2, granulin F; granulin C, epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2jyt_A Granulin-5, granulin C; epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} PDB: 2jyu_A Length = 69 | Back alignment and structure |
|---|
| >1fwo_A Oryzain beta chain; beta-hairpin stack fold, granulin/epithelin-like protein repeats, hydrolase; NMR {Synthetic} SCOP: g.3.16.1 Length = 35 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 190 | |||
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 99.94 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 99.94 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 99.94 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 99.94 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 99.94 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 99.94 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 99.94 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 99.94 | |
| 2jye_A | 72 | Granulin A; epithelin, human, stack of hairpins, a | 99.93 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 99.93 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 99.93 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 99.93 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 99.93 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 99.93 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 99.93 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 99.93 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 99.93 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 99.93 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 99.92 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 99.92 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 99.92 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 99.92 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 99.92 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 99.92 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 99.92 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 99.92 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 99.92 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 99.92 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 99.92 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 99.92 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 99.92 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 99.91 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 99.91 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 99.91 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 99.91 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 99.91 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 99.91 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 99.91 | |
| 2jyv_A | 72 | Granulin-2, granulin F; granulin C, epithelin, hum | 99.9 | |
| 2jyt_A | 69 | Granulin-5, granulin C; epithelin, human, stack of | 99.89 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 99.88 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 99.85 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 99.72 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.67 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 99.65 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.44 | |
| 1fwo_A | 35 | Oryzain beta chain; beta-hairpin stack fold, granu | 99.38 | |
| 1g26_A | 31 | Granulin A, HGA; granulin/epithelin protein repeat | 99.15 | |
| 1i8x_A | 30 | Granulin-1; two beta-hairpin stack, cytokine; NMR | 99.14 |
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A | Back alignment and structure |
|---|
Probab=99.94 E-value=9.8e-28 Score=199.38 Aligned_cols=77 Identities=69% Similarity=1.335 Sum_probs=71.1
Q ss_pred CCccCCCCeEcCCCCCCCCeEEEEEEEeeeCCEEEEEEEcCCCCCCCCCceEEEeeccCCcccCcccccccceeceecC
Q 029620 2 AFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKKG 80 (190)
Q Consensus 2 ~f~~Y~~Giy~~~c~~~~~HaV~iVGyg~~~g~~YWivkNSWG~~WGe~Gy~~i~r~~~~~~~g~CgI~~~~~yp~~~~ 80 (190)
+|++|++|||+..|+..++|||+|||||++++++|||||||||+.|||+|||||+|+.++ .++|||+++++||++..
T Consensus 143 ~f~~Y~~Giy~~~~~~~~~HaV~iVGyg~~~g~~yWivkNSWG~~WGe~Gy~~i~r~~~~--~~~Cgi~~~~~~p~~~~ 219 (220)
T 3p5u_A 143 NFQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGG--VGQCGIAKKASYPVKYY 219 (220)
T ss_dssp HHHTCCSSEECCCCCCSCCEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECCCCT--TCGGGTTSSCEEEECSC
T ss_pred hhccccCceECCCCCCccceEEEEEEEecCCCceEEEEECCCCCCcccCCEEEEECCCCC--CCccCcccccceEEEec
Confidence 599999999998898889999999999999999999999999999999999999999753 47899999999998753
|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2jye_A Granulin A; epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >2jyv_A Granulin-2, granulin F; granulin C, epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jyt_A Granulin-5, granulin C; epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} PDB: 2jyu_A | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1fwo_A Oryzain beta chain; beta-hairpin stack fold, granulin/epithelin-like protein repeats, hydrolase; NMR {Synthetic} SCOP: g.3.16.1 | Back alignment and structure |
|---|
| >1g26_A Granulin A, HGA; granulin/epithelin protein repeats, beta-hairpin stack, cytokine; NMR {Synthetic} SCOP: g.3.16.1 | Back alignment and structure |
|---|
| >1i8x_A Granulin-1; two beta-hairpin stack, cytokine; NMR {Synthetic} SCOP: g.3.16.1 PDB: 1qgm_A 1i8y_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 190 | ||||
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 4e-24 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 1e-22 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 2e-22 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 2e-22 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 3e-22 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 4e-22 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 3e-21 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 7e-20 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 8e-20 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 4e-19 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 7e-19 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 1e-18 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 9e-18 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 2e-17 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 3e-17 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 3e-17 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 1e-16 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 2e-16 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 2e-16 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 1e-15 | |
| d1fwoa_ | 35 | g.3.16.1 (A:) Oryzain beta chain {Rice (Oryza sati | 8e-15 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 6e-08 | |
| d2cb5a_ | 453 | d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi | 1e-06 |
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Chymopapain species: Papaya (Carica papaya) [TaxId: 3649]
Score = 92.3 bits (228), Expect = 4e-24
Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
Query: 3 FQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGT 62
FQLY+SG+F G CGT LDH VTAVGYGT +G +Y I+KNSWG +WGE GY+R++R G
Sbjct: 141 FQLYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQS-GN 199
Query: 63 LTGKCGIAMEASYPIKK 79
G CG+ + YP K
Sbjct: 200 SQGTCGVYKSSYYPFKG 216
|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1fwoa_ g.3.16.1 (A:) Oryzain beta chain {Rice (Oryza sativa) [TaxId: 4530]} Length = 35 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 190 | |||
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 99.93 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 99.92 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 99.92 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 99.92 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 99.92 | |
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 99.91 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 99.91 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 99.91 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 99.91 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 99.9 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 99.9 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 99.9 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 99.9 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 99.9 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 99.89 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 99.88 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 99.88 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 99.87 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 99.87 | |
| d1fwoa_ | 35 | Oryzain beta chain {Rice (Oryza sativa) [TaxId: 45 | 99.32 | |
| d1g26a_ | 31 | N-terminal domain of granulin-1 {Human (Homo sapie | 99.03 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 98.77 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 98.54 | |
| d1i8ya_ | 28 | N-terminal domain of granulin-1 {Carp (Cyprinus ca | 98.3 |
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Chymopapain species: Papaya (Carica papaya) [TaxId: 3649]
Probab=99.93 E-value=1.7e-26 Score=186.80 Aligned_cols=77 Identities=56% Similarity=1.178 Sum_probs=70.7
Q ss_pred CCccCCCCeEcCCCCCCCCeEEEEEEEeeeCCEEEEEEEcCCCCCCCCCceEEEeeccCCcccCcccccccceeceec
Q 029620 2 AFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKK 79 (190)
Q Consensus 2 ~f~~Y~~Giy~~~c~~~~~HaV~iVGyg~~~g~~YWivkNSWG~~WGe~Gy~~i~r~~~~~~~g~CgI~~~~~yp~~~ 79 (190)
.|+.|++|||...+....+|||+|||||++++++|||||||||++|||+|||||+|+.++. .+.|||++.+.||++.
T Consensus 140 ~~~~y~~Giy~~~~~~~~~Hav~IVGyg~~~g~~ywivkNSWG~~WGd~Gy~~I~~~~~~~-~~~CGI~~~~~~p~~~ 216 (218)
T d1yala_ 140 PFQLYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNS-QGTCGVYKSSYYPFKG 216 (218)
T ss_dssp HHHTCCSSEECCSCCSCCCEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECCCSBS-CCGGGTTSSCEEEECC
T ss_pred chhhcccceeeecccccCCcEEEEEEeeccCCceEEEEECCCCCCcccCCEEEEEccCCCC-CCcCCccceeeeccCC
Confidence 4678999999887777789999999999999999999999999999999999999998665 7899999999999875
|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fwoa_ g.3.16.1 (A:) Oryzain beta chain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1g26a_ g.3.16.1 (A:) N-terminal domain of granulin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i8ya_ g.3.16.1 (A:) N-terminal domain of granulin-1 {Carp (Cyprinus carpio) [TaxId: 7962]} | Back information, alignment and structure |
|---|