Citrus Sinensis ID: 029654


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MEGLGSDGAASVMKWKSDFSRKFQYYLDKSTPNTMERWLGTLAVAAIYVLRVFYVQGFYIVTYGLGIYILNLLIGFLSPSVDPELEALNTASLPTKGSDEFKPFVRRLPEFKFWYALTKAFVVAFFLTFFSVLDVPVFWPILLCYWIFLFVLTMKRQILHMIKYKYVPFNIGKPRYGKKSSENSSRIPRD
ccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccc
*************KWKSDFSRKFQYYLDKSTPNTMERWLGTLAVAAIYVLRVFYVQGFYIVTYGLGIYILNLLIGFLSPSVDP****************EFKPFVRRLPEFKFWYALTKAFVVAFFLTFFSVLDVPVFWPILLCYWIFLFVLTMKRQILHMIKYKYVPFNIG******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGLGSDGAASVMKWKSDFSRKFQYYLDKSTPNTMERWLGTLAVAAIYVLRVFYVQGFYIVTYGLGIYILNLLIGFLSPSVDPELEALNTASLPTKGSDEFKPFVRRLPEFKFWYALTKAFVVAFFLTFFSVLDVPVFWPILLCYWIFLFVLTMKRQILHMIKYKYVPFNIGKPRYGKKSSENSSRIPRD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein RER1 Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.probableQ9CQU3
Protein RER1 Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.probableQ5ZHM5
Protein RER1 Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.probableQ5R5U4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted