Citrus Sinensis ID: 029664

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MEAPETVVVDKNKKGFYSVWAIPPDEVRARVKKLMEGLRSEFGGPQFDPHVTVVGAMSLTADDALEKFKSACNGLKAYNCTVNRVATGTFFYQCVFLLLHPTPEVAEPSSHCCGHFGYKSSTPYMPHLSLLYGDLTDDEKKIAQEKAHKLDESIGSLSFPITRLQLWKTDTEDTTLKSWEMVAECNLSPD
cccccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHccccccccCEEEcccccccHHHHHHHHHHHHccccccEEEEEEEEEccEEEEEEEEEECccccccccHHHHccccccccccccccEEEEEcccccHHHHHHHHHHHHHcccccccccEECcEEEEEECcccccccccEEEEEEEEcccc
********VDKNKKGFYSVWAIPPDEVRARVKKLMEGLRSEFGGPQFDPHVTVVGAMSLTADDALEKFKSACNGLKAYNCTVNRVATGTFFYQCVFLLLHPTPEVAEPSSHCCGHFGYKSSTPYMPHLSLLYGDLTDDEKKIAQEKAHKLDESIGSLSFPITRLQLWKTDTEDTTLKSWEMVAECNLSP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAPETVVVDKNKKGFYSVWAIPPDEVRARVKKLMEGLRSEFGGPQFDPHVTVVGAMSLTADDALEKFKSACNGLKAYNCTVNRVATGTFFYQCVFLLLHPTPEVAEPSSHCCGHFGYKSSTPYMPHLSLLYGDLTDDEKKIAQEKAHKLDESIGSLSFPITRLQLWKTDTEDTTLKSWEMVAECNLSPD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cyclic phosphodiesterase Hydrolyzes APD-ribose 1",2"-cyclic phosphate (Appr>1) that is produced during tRNA splicing into ADP-ribose 1"-phosphate (Appr-1"p). Acts also on nucloside 2',3'-cyclic phosphates.probableO04147

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FSI, chain A
Confidence level:very confident
Coverage over the Query: 9-189
View the alignment between query and template
View the model in PyMOL