Citrus Sinensis ID: 029682

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19

MSSCGIDVAPEQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCSNLWSVNMAAAFQSLSWQDVHHHQAPSYASPECRIDLGSSSKCNNKISAMRTPTNKATEERVVNPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLEANNQPKLDDASGNRLMSRTALRNK

ccccccccccccEEEEEcccccEEEEEcccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccc

*********PEQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCSNLWSVNMAAAFQSLS**************************************************************FIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLE*****************R******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSCGIDVAPEQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCSNLWSVNMAAAFQSLSWQDVHHHQAPSYASPECRIDLGSSSKCNNKISAMRTPTNKATEERVVNPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLEANNQPKLDDASGNRLMSRTALRNK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Axial regulator YABBY 5		confident	Q8GW46
Protein YABBY 2		probable	Q10FZ7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YRQ, chain A
Confidence level:probable
Coverage over the Query: 59-152
View the alignment between query and template
View the model in PyMOL