Citrus Sinensis ID: 029724

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MSTGYSILSRDYSKIIKLADKCVMASSGFQADVKALQKLLAARHLIYQHQHNKQMSCPAMGQLLSNTLYYKRFFPYYSFNVLGGLDNEGKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAVDLVKTCFASATERDIYTGDKLEIVVLNKDGIHREYMELRKD
cccccEEEccccccEEEEcccEEEEccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccCEEEEEEEEcccccEEEEEEcccccEEEEcEEEEcccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccEEEEEEccccc
MSTGYSILSRDYSKIIKLADKCVMASSGFQADVKALQKLLAARHLIYQHQHNKQMSCPAMGQLLSNTLYYKRFFPYYSFNVLGGLDNEGKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAVDLVKTCFASATERDIYTGDKLEIVVLNKDGIHREYMELRK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTGYSILSRDYSKIIKLADKCVMASSGFQADVKALQKLLAARHLIYQHQHNKQMSCPAMGQLLSNTLYYKRFFPYYSFNVLGGLDNEGKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAVDLVKTCFASATERDIYTGDKLEIVVLNKDGIHREYMELRKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proteasome subunit beta type-1 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentO64464
Proteasome subunit beta type-1 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentP42742
Proteasome subunit beta type-1 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentO82531

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.25.-Threonine endopeptidases.probable
3.4.25.1Transferred entry: 3.4.25.1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RYP, chain M
Confidence level:very confident
Coverage over the Query: 2-189
View the alignment between query and template
View the model in PyMOL