BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029726
         (189 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2LYY|A Chain A, Nmr Structure Of The Protein Nb7890a From Shewanella Sp
 pdb|2LYY|B Chain B, Nmr Structure Of The Protein Nb7890a From Shewanella Sp
          Length = 96

 Score = 28.5 bits (62), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 16/30 (53%)

Query: 42 ELPSLIHQRNPNPHINTTELSKLVRWKLTR 71
          EL  L +Q+N N  I T E+S    W L R
Sbjct: 13 ELIKLANQQNQNTEIQTGEVSASFMWALAR 42


>pdb|3CG1|A Chain A, Crystal Structure Of P. Furiosus Periplasmic Binding
           Protein ModaWTPA WITH BOUND TUNGSTATE
 pdb|3CG1|B Chain B, Crystal Structure Of P. Furiosus Periplasmic Binding
           Protein ModaWTPA WITH BOUND TUNGSTATE
          Length = 296

 Score = 27.3 bits (59), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 12/65 (18%)

Query: 8   SNVNKWKEALASYEARVESLNKPN----------LISLDD-YYRKELPSLIHQRNPNPHI 56
           SN +KW E LA  + R    + PN          +I L D YY KE+   + + N N + 
Sbjct: 108 SNPDKWYEILAREDVRF-GFSDPNQDPCGYRSLMVIKLADLYYGKEIFKELIEENTNIYS 166

Query: 57  NTTEL 61
           N T++
Sbjct: 167 NGTQI 171


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.131    0.393 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,134,375
Number of Sequences: 62578
Number of extensions: 167018
Number of successful extensions: 454
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 448
Number of HSP's gapped (non-prelim): 10
length of query: 189
length of database: 14,973,337
effective HSP length: 93
effective length of query: 96
effective length of database: 9,153,583
effective search space: 878743968
effective search space used: 878743968
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)