BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 029747
(188 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1BUC|A Chain A, Three-Dimensional Structure Of Butyryl-Coa Dehydrogenase
From Megasphaera Elsdenii
pdb|1BUC|B Chain B, Three-Dimensional Structure Of Butyryl-Coa Dehydrogenase
From Megasphaera Elsdenii
Length = 383
Score = 26.9 bits (58), Expect = 6.9, Method: Compositional matrix adjust.
Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%)
Query: 87 EPFTLDVFISKRFVSASLTHRVTSKQVAVAG 117
+PFT+D I+KR V++ + RVT++ V + G
Sbjct: 314 KPFTVDAAIAKR-VASDVAMRVTTEAVQIFG 343
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.136 0.387
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,753,424
Number of Sequences: 62578
Number of extensions: 163130
Number of successful extensions: 369
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 366
Number of HSP's gapped (non-prelim): 4
length of query: 188
length of database: 14,973,337
effective HSP length: 93
effective length of query: 95
effective length of database: 9,153,583
effective search space: 869590385
effective search space used: 869590385
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)