Citrus Sinensis ID: 029771


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MGGGTGTGGAPVIAGVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVSLFLFGCLFVCLLLSWT
cccccccccHHHHHHHHHHHccEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHHHHHHcccHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccEEEEEEcccccccHHHHHHHHHHccccccccccc
******TGGAPVIAGVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVSLFLFGCLFVCLLLSWT
xxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGGTGTGGAPVIAGVAKSMGILTVGIVTTPFSFEGRRRAVQAQEGIASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVSLFLFGCLFVCLLLSWT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cell division protein FtsZ homolog 2-2, chloroplastic Exhibits GTPase activity (By similarity). Component of the plastid division machinery that forms a contractile ring at the division site.probableQ9LXJ0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VAW, chain A
Confidence level:very confident
Coverage over the Query: 11-178
View the alignment between query and template
View the model in PyMOL