BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029833
         (187 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4G1U|A Chain A, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv
           From Yersinia Pestis
 pdb|4G1U|B Chain B, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv
           From Yersinia Pestis
          Length = 357

 Score = 30.0 bits (66), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 9/71 (12%)

Query: 101 RLAKLYLATITVGSLC--------WLCDRLFCEKISLWYFNPQGHALWHTFMGFNSYFAN 152
            LA+L LA I + +LC        ++ D     + SLW     G A W T +  +S    
Sbjct: 167 NLARLLLAGIAINALCGAAVGVLTYISDDQQLRQFSLWSMGSLGQAQWSTLLVASSLILP 226

Query: 153 T-FLMFCRAQQ 162
           T  L   +A+Q
Sbjct: 227 TCILGLLQARQ 237


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.332    0.142    0.500 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,811,606
Number of Sequences: 62578
Number of extensions: 224351
Number of successful extensions: 325
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 325
Number of HSP's gapped (non-prelim): 1
length of query: 187
length of database: 14,973,337
effective HSP length: 93
effective length of query: 94
effective length of database: 9,153,583
effective search space: 860436802
effective search space used: 860436802
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 48 (23.1 bits)