Citrus Sinensis ID: 029866
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 186 | ||||||
| 359493854 | 188 | PREDICTED: thioredoxin M4, chloroplastic | 0.983 | 0.973 | 0.706 | 1e-65 | |
| 154721452 | 187 | thioredoxin [Limonium bicolor] | 0.940 | 0.935 | 0.646 | 2e-61 | |
| 418731082 | 182 | putative thioredoxin m2 [Solanum tuberos | 0.978 | 1.0 | 0.645 | 1e-58 | |
| 356546877 | 233 | PREDICTED: thioredoxin M4, chloroplastic | 0.946 | 0.755 | 0.630 | 2e-58 | |
| 224114952 | 190 | thioredoxin m [Populus trichocarpa] gi|2 | 0.989 | 0.968 | 0.619 | 6e-58 | |
| 255558409 | 181 | thioredoxin m(mitochondrial)-type, putat | 0.973 | 1.0 | 0.629 | 1e-57 | |
| 118488968 | 190 | unknown [Populus trichocarpa x Populus d | 1.0 | 0.978 | 0.626 | 1e-57 | |
| 388498220 | 173 | unknown [Medicago truncatula] | 0.784 | 0.843 | 0.711 | 2e-56 | |
| 351725393 | 182 | uncharacterized protein LOC100526924 [Gl | 0.940 | 0.961 | 0.621 | 4e-56 | |
| 329750617 | 185 | mitochondrial thioredoxin [Hevea brasili | 0.973 | 0.978 | 0.642 | 5e-56 |
| >gi|359493854|ref|XP_002282265.2| PREDICTED: thioredoxin M4, chloroplastic-like [Vitis vinifera] gi|302143024|emb|CBI20319.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 254 bits (648), Expect = 1e-65, Method: Compositional matrix adjust.
Identities = 135/191 (70%), Positives = 156/191 (81%), Gaps = 8/191 (4%)
Query: 1 MATVLECVAVPRASA--SSVFSSPAKLSSSSINSISGRRKFA---EFKGLKVRPVRSFGS 55
MATVL+ +AVPR+SA SS F A ++SS + +SGRR A EF GLK++P + S
Sbjct: 1 MATVLDSLAVPRSSALPSSAF---APIASSPVCFLSGRRGLARLPEFSGLKIQPSLASRS 57
Query: 56 VSQGSSSSFRLRRGAQIVCEAQETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCR 115
V+ SS RR +VCEAQETAVEVPAV DATWQSLVLD+ +PVLVEFWAPWCGPCR
Sbjct: 58 VAAAGRSSRVGRRVGGVVCEAQETAVEVPAVIDATWQSLVLDADTPVLVEFWAPWCGPCR 117
Query: 116 MIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPK 175
MIHP+I+EL+KQY GKLKCYKVNTDESPSIATRYGIRSIPTV+IFK+GEKK+ +IGAVPK
Sbjct: 118 MIHPVINELAKQYTGKLKCYKVNTDESPSIATRYGIRSIPTVIIFKSGEKKEAIIGAVPK 177
Query: 176 STLTTSIEKFL 186
STLTTSIEKFL
Sbjct: 178 STLTTSIEKFL 188
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|154721452|gb|ABS84825.1| thioredoxin [Limonium bicolor] | Back alignment and taxonomy information |
|---|
| >gi|418731082|gb|AFX67008.1| putative thioredoxin m2 [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|356546877|ref|XP_003541848.1| PREDICTED: thioredoxin M4, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224114952|ref|XP_002316901.1| thioredoxin m [Populus trichocarpa] gi|222859966|gb|EEE97513.1| thioredoxin m [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255558409|ref|XP_002520230.1| thioredoxin m(mitochondrial)-type, putative [Ricinus communis] gi|223540576|gb|EEF42142.1| thioredoxin m(mitochondrial)-type, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|118488968|gb|ABK96292.1| unknown [Populus trichocarpa x Populus deltoides] | Back alignment and taxonomy information |
|---|
| >gi|388498220|gb|AFK37176.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|351725393|ref|NP_001236067.1| uncharacterized protein LOC100526924 [Glycine max] gi|255631161|gb|ACU15946.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|329750617|gb|AEC03324.1| mitochondrial thioredoxin [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 186 | ||||||
| TAIR|locus:2090126 | 193 | TRX-M4 "thioredoxin M-type 4" | 1.0 | 0.963 | 0.492 | 3.8e-46 | |
| TAIR|locus:2128756 | 186 | ATHM2 [Arabidopsis thaliana (t | 0.801 | 0.801 | 0.535 | 1.1e-41 | |
| TAIR|locus:2020813 | 179 | THM1 "thioredoxin M-type 1" [A | 0.639 | 0.664 | 0.644 | 1.4e-41 | |
| UNIPROTKB|Q9ZP20 | 172 | TRXM "Thioredoxin M5, chloropl | 0.650 | 0.703 | 0.636 | 5.9e-41 | |
| UNIPROTKB|P07591 | 181 | P07591 "Thioredoxin M-type, ch | 0.639 | 0.657 | 0.621 | 4.2e-40 | |
| UNIPROTKB|P52231 | 107 | trxA "Thioredoxin" [Synechocys | 0.553 | 0.962 | 0.621 | 1.7e-34 | |
| TIGR_CMR|DET_0661 | 107 | DET_0661 "thioredoxin" [Dehalo | 0.559 | 0.971 | 0.519 | 1.2e-26 | |
| TIGR_CMR|DET_0695 | 107 | DET_0695 "thioredoxin" [Dehalo | 0.559 | 0.971 | 0.519 | 1.2e-26 | |
| TAIR|locus:2053573 | 174 | ATHM3 [Arabidopsis thaliana (t | 0.543 | 0.580 | 0.485 | 3.2e-26 | |
| UNIPROTKB|P0AA25 | 109 | trxA "thioredoxin 1" [Escheric | 0.5 | 0.853 | 0.494 | 7.8e-23 |
| TAIR|locus:2090126 TRX-M4 "thioredoxin M-type 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 484 (175.4 bits), Expect = 3.8e-46, P = 3.8e-46
Identities = 94/191 (49%), Positives = 120/191 (62%)
Query: 1 MATVLECVAVPRXXXX--XXXXXXXXXXXXXXXXXXGRRKFAEFKGLKVRPXXXXXXXXX 58
MA++L+ V V R +F EF+GLK
Sbjct: 1 MASLLDSVTVTRVFSLPIAASVSSSSAAPSVSRRRISPARFLEFRGLKSSRSLVTQSASL 60
Query: 59 XXXXXXXLRRGAQIVCEAQET---AVEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCR 115
+ RG +I CEAQ+T AVEVP ++D+ WQ+ VL+S PVLVEFWAPWCGPCR
Sbjct: 61 GANRRTRIARGGRIACEAQDTTAAAVEVPNLSDSEWQTKVLESDVPVLVEFWAPWCGPCR 120
Query: 116 MIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPK 175
MIHPI+D+L+K + GK K YK+NTDESP+ A RYGIRS+PTV+IFK GEKKD++IGAVP+
Sbjct: 121 MIHPIVDQLAKDFAGKFKFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKDSIIGAVPR 180
Query: 176 STLTTSIEKFL 186
TL +IE+FL
Sbjct: 181 ETLEKTIERFL 191
|
|
| TAIR|locus:2128756 ATHM2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2020813 THM1 "thioredoxin M-type 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9ZP20 TRXM "Thioredoxin M5, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P07591 P07591 "Thioredoxin M-type, chloroplastic" [Spinacia oleracea (taxid:3562)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P52231 trxA "Thioredoxin" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0661 DET_0661 "thioredoxin" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0695 DET_0695 "thioredoxin" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053573 ATHM3 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0AA25 trxA "thioredoxin 1" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 186 | |||
| TIGR01068 | 101 | TIGR01068, thioredoxin, thioredoxin | 6e-50 | |
| pfam00085 | 104 | pfam00085, Thioredoxin, Thioredoxin | 2e-44 | |
| cd02947 | 93 | cd02947, TRX_family, TRX family; composed of two g | 3e-41 | |
| PRK10996 | 139 | PRK10996, PRK10996, thioredoxin 2; Provisional | 2e-33 | |
| PRK09381 | 109 | PRK09381, trxA, thioredoxin; Provisional | 9e-32 | |
| COG3118 | 304 | COG3118, COG3118, Thioredoxin domain-containing pr | 1e-28 | |
| cd02961 | 101 | cd02961, PDI_a_family, Protein Disulfide Isomerase | 3e-24 | |
| COG0526 | 127 | COG0526, TrxA, Thiol-disulfide isomerase and thior | 6e-24 | |
| cd03001 | 103 | cd03001, PDI_a_P5, PDIa family, P5 subfamily; comp | 1e-20 | |
| PTZ00051 | 98 | PTZ00051, PTZ00051, thioredoxin; Provisional | 2e-20 | |
| cd02998 | 105 | cd02998, PDI_a_ERp38, PDIa family, endoplasmic ret | 1e-19 | |
| TIGR01126 | 102 | TIGR01126, pdi_dom, protein disulfide-isomerase do | 3e-19 | |
| cd02956 | 96 | cd02956, ybbN, ybbN protein family; ybbN is a hypo | 9e-18 | |
| cd02984 | 97 | cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-int | 1e-17 | |
| cd03004 | 104 | cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ER | 7e-17 | |
| cd02949 | 97 | cd02949, TRX_NTR, TRX domain, novel NADPH thioredo | 4e-16 | |
| cd02966 | 116 | cd02966, TlpA_like_family, TlpA-like family; compo | 7e-16 | |
| cd03000 | 104 | cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; | 2e-13 | |
| cd02995 | 104 | cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal T | 6e-13 | |
| cd03002 | 109 | cd03002, PDI_a_MPD1_like, PDI family, MPD1-like su | 3e-12 | |
| pfam13098 | 105 | pfam13098, Thioredoxin_2, Thioredoxin-like domain | 6e-12 | |
| TIGR01130 | 462 | TIGR01130, ER_PDI_fam, protein disulfide isomerase | 7e-12 | |
| cd03011 | 123 | cd03011, TlpA_like_ScsD_MtbDsbE, TlpA-like family, | 2e-11 | |
| cd01659 | 69 | cd01659, TRX_superfamily, Thioredoxin (TRX) superf | 3e-11 | |
| cd02989 | 113 | cd02989, Phd_like_TxnDC9, Phosducin (Phd)-like fam | 5e-11 | |
| PTZ00102 | 477 | PTZ00102, PTZ00102, disulphide isomerase; Provisio | 5e-11 | |
| cd02996 | 108 | cd02996, PDI_a_ERp44, PDIa family, endoplasmic ret | 1e-10 | |
| TIGR01130 | 462 | TIGR01130, ER_PDI_fam, protein disulfide isomerase | 2e-10 | |
| cd02950 | 142 | cd02950, TxlA, TRX-like protein A (TxlA) family; T | 2e-10 | |
| cd03005 | 102 | cd03005, PDI_a_ERp46, PDIa family, endoplasmic ret | 2e-10 | |
| PTZ00102 | 477 | PTZ00102, PTZ00102, disulphide isomerase; Provisio | 1e-09 | |
| PTZ00443 | 224 | PTZ00443, PTZ00443, Thioredoxin domain-containing | 1e-09 | |
| pfam13905 | 94 | pfam13905, Thioredoxin_8, Thioredoxin-like | 4e-09 | |
| cd02997 | 104 | cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; | 5e-09 | |
| TIGR00385 | 173 | TIGR00385, dsbE, periplasmic protein thiol:disulfi | 7e-09 | |
| cd02994 | 101 | cd02994, PDI_a_TMX, PDIa family, TMX subfamily; co | 1e-08 | |
| cd02962 | 152 | cd02962, TMX2, TMX2 family; composed of proteins s | 1e-08 | |
| cd03010 | 127 | cd03010, TlpA_like_DsbE, TlpA-like family, DsbE (a | 9e-08 | |
| TIGR00411 | 82 | TIGR00411, redox_disulf_1, small redox-active disu | 4e-07 | |
| cd02999 | 100 | cd02999, PDI_a_ERp44_like, PDIa family, endoplasmi | 5e-07 | |
| PHA02125 | 75 | PHA02125, PHA02125, thioredoxin-like protein | 8e-07 | |
| cd02957 | 113 | cd02957, Phd_like, Phosducin (Phd)-like family; co | 1e-06 | |
| PRK03147 | 173 | PRK03147, PRK03147, thiol-disulfide oxidoreductase | 2e-06 | |
| PRK15412 | 185 | PRK15412, PRK15412, thiol:disulfide interchange pr | 8e-06 | |
| cd02948 | 102 | cd02948, TRX_NDPK, TRX domain, TRX and NDP-kinase | 1e-05 | |
| cd02953 | 104 | cd02953, DsbDgamma, DsbD gamma family; DsbD gamma | 2e-05 | |
| pfam13899 | 81 | pfam13899, Thioredoxin_7, Thioredoxin-like | 3e-05 | |
| cd02985 | 103 | cd02985, TRX_CDSP32, TRX family, chloroplastic dro | 4e-05 | |
| cd03003 | 101 | cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ER | 5e-05 | |
| cd02992 | 114 | cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhyd | 1e-04 | |
| pfam08534 | 142 | pfam08534, Redoxin, Redoxin | 0.004 |
| >gnl|CDD|200072 TIGR01068, thioredoxin, thioredoxin | Back alignment and domain information |
|---|
Score = 156 bits (396), Expect = 6e-50
Identities = 56/101 (55%), Positives = 77/101 (76%)
Query: 86 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSI 145
+TDA + + S PVLV+FWAPWCGPC+MI PI++EL+K+Y GK+K K+N DE+P I
Sbjct: 1 LTDANFDETIASSDKPVLVDFWAPWCGPCKMIAPILEELAKEYEGKVKFVKLNVDENPDI 60
Query: 146 ATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL 186
A +YGIRSIPT+++FKNG++ D +GA+PK+ L I K L
Sbjct: 61 AAKYGIRSIPTLLLFKNGKEVDRSVGALPKAALKQLINKNL 101
|
Several proteins, such as protein disulfide isomerase, have two or more copies of a domain closely related to thioredoxin. This model is designed to recognize authentic thioredoxin, a small protein that should be hit exactly once by This model. Any protein that hits once with a score greater than the second (per domain) trusted cutoff may be taken as thioredoxin [Energy metabolism, Electron transport]. Length = 101 |
| >gnl|CDD|215704 pfam00085, Thioredoxin, Thioredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|239245 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >gnl|CDD|182889 PRK10996, PRK10996, thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181812 PRK09381, trxA, thioredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225660 COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >gnl|CDD|223600 COG0526, TrxA, Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|239299 cd03001, PDI_a_P5, PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >gnl|CDD|173347 PTZ00051, PTZ00051, thioredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239296 cd02998, PDI_a_ERp38, PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >gnl|CDD|200074 TIGR01126, pdi_dom, protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >gnl|CDD|239254 cd02956, ybbN, ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|239282 cd02984, TRX_PICOT, TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >gnl|CDD|239302 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >gnl|CDD|239247 cd02949, TRX_NTR, TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >gnl|CDD|239264 cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239298 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|239293 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >gnl|CDD|239300 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >gnl|CDD|221921 pfam13098, Thioredoxin_2, Thioredoxin-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic | Back alignment and domain information |
|---|
| >gnl|CDD|239309 cd03011, TlpA_like_ScsD_MtbDsbE, TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >gnl|CDD|238829 cd01659, TRX_superfamily, Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >gnl|CDD|239287 cd02989, Phd_like_TxnDC9, Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239294 cd02996, PDI_a_ERp44, PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic | Back alignment and domain information |
|---|
| >gnl|CDD|239248 cd02950, TxlA, TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >gnl|CDD|239303 cd03005, PDI_a_ERp46, PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185622 PTZ00443, PTZ00443, Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222448 pfam13905, Thioredoxin_8, Thioredoxin-like | Back alignment and domain information |
|---|
| >gnl|CDD|239295 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >gnl|CDD|129481 TIGR00385, dsbE, periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239292 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >gnl|CDD|239260 cd02962, TMX2, TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >gnl|CDD|239308 cd03010, TlpA_like_DsbE, TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif | Back alignment and domain information |
|---|
| >gnl|CDD|129505 TIGR00411, redox_disulf_1, small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|239297 cd02999, PDI_a_ERp44_like, PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >gnl|CDD|133998 PHA02125, PHA02125, thioredoxin-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|239255 cd02957, Phd_like, Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >gnl|CDD|179545 PRK03147, PRK03147, thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185310 PRK15412, PRK15412, thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239246 cd02948, TRX_NDPK, TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >gnl|CDD|239251 cd02953, DsbDgamma, DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >gnl|CDD|222442 pfam13899, Thioredoxin_7, Thioredoxin-like | Back alignment and domain information |
|---|
| >gnl|CDD|239283 cd02985, TRX_CDSP32, TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >gnl|CDD|239301 cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >gnl|CDD|239290 cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >gnl|CDD|219888 pfam08534, Redoxin, Redoxin | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 186 | |||
| KOG0910 | 150 | consensus Thioredoxin-like protein [Posttranslatio | 99.97 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 99.93 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 99.93 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 99.92 | |
| cd03006 | 113 | PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil | 99.92 | |
| PHA02278 | 103 | thioredoxin-like protein | 99.92 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 99.92 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 99.92 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 99.91 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 99.91 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 99.91 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 99.91 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 99.9 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 99.9 | |
| KOG0907 | 106 | consensus Thioredoxin [Posttranslational modificat | 99.9 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 99.9 | |
| PLN00410 | 142 | U5 snRNP protein, DIM1 family; Provisional | 99.89 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 99.89 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 99.89 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 99.89 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 99.89 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 99.88 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 99.88 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 99.88 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 99.88 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 99.87 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 99.87 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 99.87 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 99.87 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 99.86 | |
| cd02986 | 114 | DLP Dim1 family, Dim1-like protein (DLP) subfamily | 99.86 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 99.86 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 99.86 | |
| cd02962 | 152 | TMX2 TMX2 family; composed of proteins similar to | 99.86 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 99.85 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 99.85 | |
| cd02995 | 104 | PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain | 99.84 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 99.84 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 99.83 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 99.83 | |
| cd02987 | 175 | Phd_like_Phd Phosducin (Phd)-like family, Phd subf | 99.83 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 99.83 | |
| cd02993 | 109 | PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat | 99.83 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 99.82 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 99.81 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 99.81 | |
| KOG0908 | 288 | consensus Thioredoxin-like protein [Posttranslatio | 99.8 | |
| cd02988 | 192 | Phd_like_VIAF Phosducin (Phd)-like family, Viral i | 99.78 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 99.78 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 99.77 | |
| cd02992 | 114 | PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas | 99.77 | |
| TIGR00424 | 463 | APS_reduc 5'-adenylylsulfate reductase, thioredoxi | 99.76 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 99.76 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 99.76 | |
| PLN02309 | 457 | 5'-adenylylsulfate reductase | 99.75 | |
| cd02982 | 103 | PDI_b'_family Protein Disulfide Isomerase (PDIb') | 99.74 | |
| KOG0190 | 493 | consensus Protein disulfide isomerase (prolyl 4-hy | 99.74 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 99.74 | |
| PRK15412 | 185 | thiol:disulfide interchange protein DsbE; Provisio | 99.72 | |
| cd02952 | 119 | TRP14_like Human TRX-related protein 14 (TRP14)-li | 99.72 | |
| cd03007 | 116 | PDI_a_ERp29_N PDIa family, endoplasmic reticulum p | 99.71 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 99.71 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 99.68 | |
| TIGR00385 | 173 | dsbE periplasmic protein thiol:disulfide oxidoredu | 99.68 | |
| PRK14018 | 521 | trifunctional thioredoxin/methionine sulfoxide red | 99.68 | |
| cd02959 | 117 | ERp19 Endoplasmic reticulum protein 19 (ERp19) fam | 99.67 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 99.66 | |
| cd03010 | 127 | TlpA_like_DsbE TlpA-like family, DsbE (also known | 99.66 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 99.66 | |
| TIGR02738 | 153 | TrbB type-F conjugative transfer system pilin asse | 99.65 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 99.64 | |
| PRK11509 | 132 | hydrogenase-1 operon protein HyaE; Provisional | 99.63 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 99.63 | |
| PRK00293 | 571 | dipZ thiol:disulfide interchange protein precursor | 99.63 | |
| cd02955 | 124 | SSP411 TRX domain, SSP411 protein family; members | 99.62 | |
| PHA02125 | 75 | thioredoxin-like protein | 99.62 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 99.61 | |
| KOG0190 | 493 | consensus Protein disulfide isomerase (prolyl 4-hy | 99.61 | |
| cd03008 | 146 | TryX_like_RdCVF Tryparedoxin (TryX)-like family, R | 99.6 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 99.6 | |
| KOG4277 | 468 | consensus Uncharacterized conserved protein, conta | 99.59 | |
| PLN02399 | 236 | phospholipid hydroperoxide glutathione peroxidase | 99.58 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 99.58 | |
| cd03009 | 131 | TryX_like_TryX_NRX Tryparedoxin (TryX)-like family | 99.57 | |
| cd03011 | 123 | TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso | 99.57 | |
| cd02964 | 132 | TryX_like_family Tryparedoxin (TryX)-like family; | 99.55 | |
| PF13905 | 95 | Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ | 99.55 | |
| KOG0912 | 375 | consensus Thiol-disulfide isomerase and thioredoxi | 99.54 | |
| PTZ00056 | 199 | glutathione peroxidase; Provisional | 99.54 | |
| PRK13728 | 181 | conjugal transfer protein TrbB; Provisional | 99.53 | |
| KOG0191 | 383 | consensus Thioredoxin/protein disulfide isomerase | 99.52 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 99.51 | |
| cd02967 | 114 | mauD Methylamine utilization (mau) D family; mauD | 99.51 | |
| cd02966 | 116 | TlpA_like_family TlpA-like family; composed of Tlp | 99.5 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 99.5 | |
| TIGR01626 | 184 | ytfJ_HI0045 conserved hypothetical protein YtfJ-fa | 99.5 | |
| TIGR02540 | 153 | gpx7 putative glutathione peroxidase Gpx7. This mo | 99.49 | |
| PF08534 | 146 | Redoxin: Redoxin; InterPro: IPR013740 This redoxin | 99.49 | |
| cd02958 | 114 | UAS UAS family; UAS is a domain of unknown functio | 99.49 | |
| cd03012 | 126 | TlpA_like_DipZ_like TlpA-like family, DipZ-like su | 99.46 | |
| PLN02412 | 167 | probable glutathione peroxidase | 99.45 | |
| PRK10877 | 232 | protein disulfide isomerase II DsbC; Provisional | 99.44 | |
| TIGR02661 | 189 | MauD methylamine dehydrogenase accessory protein M | 99.43 | |
| cd00340 | 152 | GSH_Peroxidase Glutathione (GSH) peroxidase family | 99.41 | |
| cd02969 | 171 | PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot | 99.39 | |
| KOG0191 | 383 | consensus Thioredoxin/protein disulfide isomerase | 99.39 | |
| KOG1731 | 606 | consensus FAD-dependent sulfhydryl oxidase/quiesci | 99.35 | |
| PTZ00256 | 183 | glutathione peroxidase; Provisional | 99.34 | |
| smart00594 | 122 | UAS UAS domain. | 99.3 | |
| cd02960 | 130 | AGR Anterior Gradient (AGR) family; members of thi | 99.3 | |
| COG0526 | 127 | TrxA Thiol-disulfide isomerase and thioredoxins [P | 99.3 | |
| cd03017 | 140 | PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit | 99.29 | |
| COG4232 | 569 | Thiol:disulfide interchange protein [Posttranslati | 99.27 | |
| cd03020 | 197 | DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil | 99.26 | |
| PF13899 | 82 | Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ | 99.19 | |
| PRK09437 | 154 | bcp thioredoxin-dependent thiol peroxidase; Review | 99.17 | |
| PRK00522 | 167 | tpx lipid hydroperoxide peroxidase; Provisional | 99.16 | |
| cd03014 | 143 | PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical | 99.14 | |
| PRK10606 | 183 | btuE putative glutathione peroxidase; Provisional | 99.13 | |
| PF00578 | 124 | AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per | 99.13 | |
| KOG2501 | 157 | consensus Thioredoxin, nucleoredoxin and related p | 99.12 | |
| cd03015 | 173 | PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- | 99.1 | |
| PRK11657 | 251 | dsbG disulfide isomerase/thiol-disulfide oxidase; | 99.09 | |
| COG2143 | 182 | Thioredoxin-related protein [Posttranslational mod | 99.08 | |
| TIGR03137 | 187 | AhpC peroxiredoxin. This gene contains two invaria | 99.08 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 99.07 | |
| KOG0914 | 265 | consensus Thioredoxin-like protein [Posttranslatio | 99.07 | |
| cd03018 | 149 | PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik | 99.06 | |
| cd02970 | 149 | PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot | 99.02 | |
| PF14595 | 129 | Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. | 99.02 | |
| cd02968 | 142 | SCO SCO (an acronym for Synthesis of Cytochrome c | 99.02 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 99.02 | |
| PF02114 | 265 | Phosducin: Phosducin; InterPro: IPR024253 The oute | 99.02 | |
| cd02971 | 140 | PRX_family Peroxiredoxin (PRX) family; composed of | 99.01 | |
| PF03190 | 163 | Thioredox_DsbH: Protein of unknown function, DUF25 | 98.98 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 98.98 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 98.95 | |
| PRK10382 | 187 | alkyl hydroperoxide reductase subunit C; Provision | 98.95 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 98.9 | |
| PRK13190 | 202 | putative peroxiredoxin; Provisional | 98.89 | |
| cd02991 | 116 | UAS_ETEA UAS family, ETEA subfamily; composed of p | 98.84 | |
| cd03016 | 203 | PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub | 98.82 | |
| PRK15000 | 200 | peroxidase; Provisional | 98.81 | |
| KOG1672 | 211 | consensus ATP binding protein [Posttranslational m | 98.79 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 98.76 | |
| PRK13599 | 215 | putative peroxiredoxin; Provisional | 98.76 | |
| KOG0913 | 248 | consensus Thiol-disulfide isomerase and thioredoxi | 98.73 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 98.72 | |
| KOG3414 | 142 | consensus Component of the U4/U6.U5 snRNP/mitosis | 98.72 | |
| PTZ00137 | 261 | 2-Cys peroxiredoxin; Provisional | 98.7 | |
| PRK13189 | 222 | peroxiredoxin; Provisional | 98.69 | |
| TIGR02739 | 256 | TraF type-F conjugative transfer system pilin asse | 98.68 | |
| PF07449 | 107 | HyaE: Hydrogenase-1 expression protein HyaE; Inter | 98.66 | |
| PRK13191 | 215 | putative peroxiredoxin; Provisional | 98.65 | |
| PF06110 | 119 | DUF953: Eukaryotic protein of unknown function (DU | 98.65 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 98.64 | |
| PRK13703 | 248 | conjugal pilus assembly protein TraF; Provisional | 98.61 | |
| PF02966 | 133 | DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th | 98.6 | |
| PF13848 | 184 | Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ | 98.58 | |
| cd03023 | 154 | DsbA_Com1_like DsbA family, Com1-like subfamily; c | 98.56 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 98.55 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 98.54 | |
| cd03019 | 178 | DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m | 98.51 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 98.49 | |
| KOG3425 | 128 | consensus Uncharacterized conserved protein [Funct | 98.45 | |
| PF13462 | 162 | Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV | 98.43 | |
| PTZ00253 | 199 | tryparedoxin peroxidase; Provisional | 98.43 | |
| PF01216 | 383 | Calsequestrin: Calsequestrin; InterPro: IPR001393 | 98.38 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 98.36 | |
| PF11009 | 105 | DUF2847: Protein of unknown function (DUF2847); In | 98.36 | |
| cd03072 | 111 | PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second | 98.36 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 98.35 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 98.35 | |
| COG1225 | 157 | Bcp Peroxiredoxin [Posttranslational modification, | 98.34 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 98.3 | |
| PRK10954 | 207 | periplasmic protein disulfide isomerase I; Provisi | 98.24 | |
| cd02983 | 130 | P5_C P5 family, C-terminal redox inactive TRX-like | 98.23 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 98.2 | |
| cd03073 | 111 | PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s | 98.16 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 98.11 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 98.09 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 98.06 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 98.02 | |
| cd02972 | 98 | DsbA_family DsbA family; consists of DsbA and DsbA | 98.02 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 97.95 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 97.94 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 97.93 | |
| cd02981 | 97 | PDI_b_family Protein Disulfide Isomerase (PDIb) fa | 97.92 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 97.9 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 97.88 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 97.85 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 97.82 | |
| COG1331 | 667 | Highly conserved protein containing a thioredoxin | 97.82 | |
| PF13743 | 176 | Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C. | 97.82 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 97.76 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 97.7 | |
| KOG2603 | 331 | consensus Oligosaccharyltransferase, gamma subunit | 97.64 | |
| KOG3171 | 273 | consensus Conserved phosducin-like protein [Signal | 97.6 | |
| PF00837 | 237 | T4_deiodinase: Iodothyronine deiodinase; InterPro: | 97.58 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 97.52 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 97.5 | |
| cd03013 | 155 | PRX5_like Peroxiredoxin (PRX) family, PRX5-like su | 97.49 | |
| COG0386 | 162 | BtuE Glutathione peroxidase [Posttranslational mod | 97.46 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 97.41 | |
| PF07912 | 126 | ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 | 97.29 | |
| PF01323 | 193 | DSBA: DSBA-like thioredoxin domain; InterPro: IPR0 | 97.26 | |
| KOG3170 | 240 | consensus Conserved phosducin-like protein [Signal | 97.25 | |
| COG1651 | 244 | DsbG Protein-disulfide isomerase [Posttranslationa | 96.89 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 96.83 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 96.82 | |
| PF13848 | 184 | Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ | 96.82 | |
| KOG1752 | 104 | consensus Glutaredoxin and related proteins [Postt | 96.79 | |
| COG2761 | 225 | FrnE Predicted dithiol-disulfide isomerase involve | 96.78 | |
| cd03067 | 112 | PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin | 96.3 | |
| cd02974 | 94 | AhpF_NTD_N Alkyl hydroperoxide reductase F subunit | 96.28 | |
| KOG2640 | 319 | consensus Thioredoxin [Function unknown] | 96.25 | |
| COG3019 | 149 | Predicted metal-binding protein [General function | 96.11 | |
| cd03066 | 102 | PDI_b_Calsequestrin_middle PDIb family, Calsequest | 95.91 | |
| KOG1651 | 171 | consensus Glutathione peroxidase [Posttranslationa | 95.73 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 95.72 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 95.63 | |
| COG1999 | 207 | Uncharacterized protein SCO1/SenC/PrrC, involved i | 95.35 | |
| COG0450 | 194 | AhpC Peroxiredoxin [Posttranslational modification | 95.34 | |
| cd02978 | 72 | KaiB_like KaiB-like family; composed of the circad | 95.31 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 95.29 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 95.27 | |
| cd03069 | 104 | PDI_b_ERp57 PDIb family, ERp57 subfamily, first re | 95.16 | |
| COG3531 | 212 | Predicted protein-disulfide isomerase [Posttransla | 95.03 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 95.03 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 94.67 | |
| TIGR02654 | 87 | circ_KaiB circadian clock protein KaiB. Members of | 94.58 | |
| PRK09301 | 103 | circadian clock protein KaiB; Provisional | 94.55 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 94.52 | |
| cd02990 | 136 | UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1 | 94.39 | |
| KOG0855 | 211 | consensus Alkyl hydroperoxide reductase, thiol spe | 93.94 | |
| COG4545 | 85 | Glutaredoxin-related protein [Posttranslational mo | 93.94 | |
| PF09673 | 113 | TrbC_Ftype: Type-F conjugative transfer system pil | 93.82 | |
| TIGR02742 | 130 | TrbC_Ftype type-F conjugative transfer system pili | 93.3 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 92.98 | |
| PF13778 | 118 | DUF4174: Domain of unknown function (DUF4174) | 92.53 | |
| PF02630 | 174 | SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam | 92.05 | |
| PF09822 | 271 | ABC_transp_aux: ABC-type uncharacterized transport | 91.92 | |
| cd03024 | 201 | DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a D | 91.66 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 91.62 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 91.49 | |
| KOG2507 | 506 | consensus Ubiquitin regulatory protein UBXD2, cont | 90.88 | |
| cd03025 | 193 | DsbA_FrnE_like DsbA family, FrnE-like subfamily; c | 90.81 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 90.54 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 90.32 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 90.12 | |
| PF00255 | 108 | GSHPx: Glutathione peroxidase; InterPro: IPR000889 | 89.75 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 89.66 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 89.45 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 89.36 | |
| cd03074 | 120 | PDI_b'_Calsequestrin_C Protein Disulfide Isomerase | 89.26 | |
| PHA03075 | 123 | glutaredoxin-like protein; Provisional | 89.1 | |
| cd03068 | 107 | PDI_b_ERp72 PDIb family, ERp72 subfamily, first re | 88.4 | |
| KOG2792 | 280 | consensus Putative cytochrome C oxidase assembly p | 87.73 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 87.71 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 87.54 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 86.95 | |
| cd03022 | 192 | DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-car | 86.38 | |
| PF06053 | 249 | DUF929: Domain of unknown function (DUF929); Inter | 86.07 | |
| PF07689 | 82 | KaiB: KaiB domain; InterPro: IPR011649 The cyanoba | 85.88 | |
| PF04134 | 114 | DUF393: Protein of unknown function, DUF393; Inter | 85.77 | |
| KOG2244 | 786 | consensus Highly conserved protein containing a th | 84.76 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 84.58 | |
| PRK00366 | 360 | ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s | 83.19 | |
| KOG0852 | 196 | consensus Alkyl hydroperoxide reductase, thiol spe | 82.8 | |
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 82.39 |
| >KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.7e-30 Score=189.46 Aligned_cols=106 Identities=50% Similarity=0.956 Sum_probs=101.4
Q ss_pred ccccccChhHHHHHHHhCCCcEEEEEECCCCcccccchHHHHHHHHHhcCceEEEEEeCCCChHHHHHcCCCcccEEEEE
Q 029866 81 VEVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIF 160 (186)
Q Consensus 81 ~~v~~l~~~~~~~~~~~~~k~vvv~F~a~wC~~C~~~~p~l~~l~~~~~~~v~~~~v~~d~~~~l~~~~~i~~~Pt~i~~ 160 (186)
.....++..+|++.+.+++.||+|+|||+||+||+++.|.++++..+|.++++++++|+|++.+++.+|+|..+||+++|
T Consensus 43 ~~~~~~s~~~~~~~Vi~S~~PVlVdF~A~WCgPCk~l~P~l~~~~~~~~g~~k~~kvdtD~~~ela~~Y~I~avPtvlvf 122 (150)
T KOG0910|consen 43 TLFNVQSDSEFDDKVINSDVPVLVDFHAEWCGPCKMLGPILEELVSEYAGKFKLYKVDTDEHPELAEDYEISAVPTVLVF 122 (150)
T ss_pred ccccccCHHHHHHHHHccCCCEEEEEecCcCccHhHhhHHHHHHHHhhcCeEEEEEEccccccchHhhcceeeeeEEEEE
Confidence 44566789999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eCCeEEEEEeCCCCHHHHHHHHHhhC
Q 029866 161 KNGEKKDTVIGAVPKSTLTTSIEKFL 186 (186)
Q Consensus 161 ~~G~~~~~~~G~~~~~~l~~~l~~~l 186 (186)
+||+++.++.|..+.+.|.++|+++|
T Consensus 123 knGe~~d~~vG~~~~~~l~~~i~k~l 148 (150)
T KOG0910|consen 123 KNGEKVDRFVGAVPKEQLRSLIKKFL 148 (150)
T ss_pred ECCEEeeeecccCCHHHHHHHHHHHh
Confidence 99999999999999999999999875
|
|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >PLN00410 U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >PLN02309 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK15412 thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 | Back alignment and domain information |
|---|
| >cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional | Back alignment and domain information |
|---|
| >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >PRK11509 hydrogenase-1 operon protein HyaE; Provisional | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02399 phospholipid hydroperoxide glutathione peroxidase | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif | Back alignment and domain information |
|---|
| >cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX | Back alignment and domain information |
|---|
| >PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A | Back alignment and domain information |
|---|
| >KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00056 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13728 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source | Back alignment and domain information |
|---|
| >cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 | Back alignment and domain information |
|---|
| >TIGR02540 gpx7 putative glutathione peroxidase Gpx7 | Back alignment and domain information |
|---|
| >PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins | Back alignment and domain information |
|---|
| >cd02958 UAS UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
| >cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain | Back alignment and domain information |
|---|
| >PLN02412 probable glutathione peroxidase | Back alignment and domain information |
|---|
| >PRK10877 protein disulfide isomerase II DsbC; Provisional | Back alignment and domain information |
|---|
| >TIGR02661 MauD methylamine dehydrogenase accessory protein MauD | Back alignment and domain information |
|---|
| >cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate | Back alignment and domain information |
|---|
| >cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00256 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >smart00594 UAS UAS domain | Back alignment and domain information |
|---|
| >cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus | Back alignment and domain information |
|---|
| >COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides | Back alignment and domain information |
|---|
| >COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A | Back alignment and domain information |
|---|
| >PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed | Back alignment and domain information |
|---|
| >PRK00522 tpx lipid hydroperoxide peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) | Back alignment and domain information |
|---|
| >PRK10606 btuE putative glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells | Back alignment and domain information |
|---|
| >KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides | Back alignment and domain information |
|---|
| >PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional | Back alignment and domain information |
|---|
| >COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03137 AhpC peroxiredoxin | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE | Back alignment and domain information |
|---|
| >cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A | Back alignment and domain information |
|---|
| >cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin | Back alignment and domain information |
|---|
| >cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified | Back alignment and domain information |
|---|
| >PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >PRK10382 alkyl hydroperoxide reductase subunit C; Provisional | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >PRK13190 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals | Back alignment and domain information |
|---|
| >cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine | Back alignment and domain information |
|---|
| >PRK15000 peroxidase; Provisional | Back alignment and domain information |
|---|
| >KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >PRK13599 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >KOG3414 consensus Component of the U4/U6 | Back alignment and domain information |
|---|
| >PTZ00137 2-Cys peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK13189 peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF | Back alignment and domain information |
|---|
| >PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long | Back alignment and domain information |
|---|
| >PRK13191 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >PRK13703 conjugal pilus assembly protein TraF; Provisional | Back alignment and domain information |
|---|
| >PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A | Back alignment and domain information |
|---|
| >cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3425 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A | Back alignment and domain information |
|---|
| >PTZ00253 tryparedoxin peroxidase; Provisional | Back alignment and domain information |
|---|
| >PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol | Back alignment and domain information |
|---|
| >cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >PRK10954 periplasmic protein disulfide isomerase I; Provisional | Back alignment and domain information |
|---|
| >cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13743 Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3171 consensus Conserved phosducin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol | Back alignment and domain information |
|---|
| >COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] | Back alignment and domain information |
|---|
| >PF01323 DSBA: DSBA-like thioredoxin domain; InterPro: IPR001853 DSBA is a sub-family of the Thioredoxin family [] | Back alignment and domain information |
|---|
| >KOG3170 consensus Conserved phosducin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A | Back alignment and domain information |
|---|
| >KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2761 FrnE Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >cd02974 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) family, N-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >KOG2640 consensus Thioredoxin [Function unknown] | Back alignment and domain information |
|---|
| >COG3019 Predicted metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >KOG1651 consensus Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] | Back alignment and domain information |
|---|
| >COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02978 KaiB_like KaiB-like family; composed of the circadian clock proteins, KaiB and the N-terminal KaiB-like sensory domain of SasA | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >COG3531 Predicted protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >TIGR02654 circ_KaiB circadian clock protein KaiB | Back alignment and domain information |
|---|
| >PRK09301 circadian clock protein KaiB; Provisional | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd02990 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1) subfamily; FAF1 contains a UAS domain of unknown function N-terminal to a ubiquitin-associated UBX domain | Back alignment and domain information |
|---|
| >KOG0855 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09673 TrbC_Ftype: Type-F conjugative transfer system pilin assembly protein; InterPro: IPR019106 This entry represents TrbC, a protein that is an essential component of the F-type conjugative pilus assembly system (aka type 4 secretion system) for the transfer of plasmid DNA [, ] | Back alignment and domain information |
|---|
| >TIGR02742 TrbC_Ftype type-F conjugative transfer system pilin assembly protein TrbC | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >PF13778 DUF4174: Domain of unknown function (DUF4174) | Back alignment and domain information |
|---|
| >PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems | Back alignment and domain information |
|---|
| >PF09822 ABC_transp_aux: ABC-type uncharacterized transport system; InterPro: IPR019196 This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins | Back alignment and domain information |
|---|
| >cd03024 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd03025 DsbA_FrnE_like DsbA family, FrnE-like subfamily; composed of uncharacterized proteins containing a CXXC motif with similarity to DsbA and FrnE | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >PF00255 GSHPx: Glutathione peroxidase; InterPro: IPR000889 Glutathione peroxidase (GSHPx) (1 | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >PHA03075 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >KOG2792 consensus Putative cytochrome C oxidase assembly protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway | Back alignment and domain information |
|---|
| >PF06053 DUF929: Domain of unknown function (DUF929); InterPro: IPR009272 This is a family of proteins from the archaeon Sulfolobus, with undetermined function | Back alignment and domain information |
|---|
| >PF07689 KaiB: KaiB domain; InterPro: IPR011649 The cyanobacterial clock proteins KaiA and KaiB are proposed as regulators of the circadian rhythm in cyanobacteria | Back alignment and domain information |
|---|
| >PF04134 DUF393: Protein of unknown function, DUF393; InterPro: IPR007263 The DCC family, named after the conserved N-terminal DxxCxxC motif, encompasses COG3011 from COG | Back alignment and domain information |
|---|
| >KOG2244 consensus Highly conserved protein containing a thioredoxin domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed | Back alignment and domain information |
|---|
| >KOG0852 consensus Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 186 | ||||
| 1fb0_A | 105 | Crystal Structure Of Thioredoxin M From Spinach Chl | 6e-40 | ||
| 1gl8_A | 104 | Solution Structure Of Thioredoxin M From Spinach, O | 3e-39 | ||
| 2puk_C | 106 | Crystal Srtucture Of The Binary Complex Between Fer | 4e-39 | ||
| 1dby_A | 107 | Nmr Structures Of Chloroplast Thioredoxin M Ch2 Fro | 1e-36 | ||
| 2yj7_A | 106 | Crystal Structure Of A Hyperstable Protein From The | 1e-28 | ||
| 2fch_A | 108 | Crystal Structure Of Thioredoxin Mutant G74s Length | 2e-25 | ||
| 3dxb_A | 222 | Structure Of The Uhm Domain Of Puf60 Fused To Thior | 2e-25 | ||
| 1zzy_A | 108 | Crystal Structure Of Thioredoxin Mutant L7v Length | 3e-25 | ||
| 2h75_A | 108 | Crystal Structure Of Thioredoxin Mutant D13e In Hex | 4e-25 | ||
| 2h71_A | 108 | Crystal Structure Of Thioredoxin Mutant D47e In Hex | 5e-25 | ||
| 2h76_A | 108 | Crystal Structure Of Thioredoxin Mutant D10e In Hex | 5e-25 | ||
| 2h74_A | 108 | Crystal Structure Of Thioredoxin Mutant D2e In Hexa | 6e-25 | ||
| 2trx_A | 108 | Crystal Structure Of Thioredoxin From Escherichia C | 6e-25 | ||
| 1xob_A | 108 | Thioredoxin (Reduced Dithio Form), Nmr, 20 Structur | 6e-25 | ||
| 2eio_A | 108 | Design Of Disulfide-Linked Thioredoxin Dimers And M | 8e-25 | ||
| 2h6y_A | 108 | Crystal Structure Of Thioredoxin Mutant E48d In Hex | 9e-25 | ||
| 2tir_A | 108 | Crystal Structure Analysis Of A Mutant Escherichia | 1e-24 | ||
| 2h6z_A | 108 | Crystal Structure Of Thioredoxin Mutant E44d In Hex | 1e-24 | ||
| 2h72_A | 108 | Crystal Structure Of Thioredoxin Mutant E85d In Hex | 1e-24 | ||
| 2eir_A | 108 | Design Of Disulfide-Linked Thioredoxin Dimers And M | 1e-24 | ||
| 3dyr_A | 111 | Crystal Structure Of E. Coli Thioredoxin Mutant I76 | 2e-24 | ||
| 2h70_A | 108 | Crystal Structure Of Thioredoxin Mutant D9e In Hexa | 2e-24 | ||
| 2h73_A | 108 | Crystal Structure Of Thioredoxin Mutant D43e In Hex | 2e-24 | ||
| 2eiq_A | 108 | Design Of Disulfide-linked Thioredoxin Dimers And M | 3e-24 | ||
| 2o8v_B | 128 | Paps Reductase In A Covalent Complex With Thioredox | 5e-24 | ||
| 2fd3_A | 108 | Crystal Structure Of Thioredoxin Mutant P34h Length | 5e-24 | ||
| 1f6m_C | 108 | Crystal Structure Of A Complex Between Thioredoxin | 6e-24 | ||
| 1keb_A | 108 | Crystal Structure Of Double Mutant M37l,P40s E.Coli | 1e-23 | ||
| 1t00_A | 112 | The Structure Of Thioredoxin From S. Coelicolor Len | 1e-23 | ||
| 1tho_A | 109 | Crystal Structure Of A Mutant Escherichia Coli Thio | 1e-23 | ||
| 1v98_A | 140 | Crystal Structure Analysis Of Thioredoxin From Ther | 4e-23 | ||
| 1txx_A | 108 | Active-Site Variant Of E.Coli Thioredoxin Length = | 2e-22 | ||
| 2o7k_A | 107 | S. Aureus Thioredoxin Length = 107 | 2e-22 | ||
| 2i4a_A | 107 | Crystal Structure Of Thioredoxin From The Acidophil | 3e-22 | ||
| 1srx_A | 108 | Three-Dimensional Structure Of Escherichia Coli Thi | 4e-22 | ||
| 1zcp_A | 108 | Crystal Structure Of A Catalytic Site Mutant E. Col | 4e-22 | ||
| 1oaz_A | 123 | Ige Fv Spe7 Complexed With A Recombinant Thioredoxi | 5e-22 | ||
| 2cvk_A | 110 | Crystal Structure Of Thermus Thermophilus Thioredox | 5e-22 | ||
| 2yzu_A | 109 | Crystal Structure Of Oxidized Thioredoxin From Ther | 5e-22 | ||
| 1rqm_A | 105 | Solution Structure Of The K18gR82E ALICYCLOBACILLUS | 6e-22 | ||
| 2o87_A | 106 | S. Aureus Thioredoxin P31s Mutant Length = 106 | 2e-21 | ||
| 2o85_A | 107 | S. Aureus Thioredoxin P31t Mutant Length = 107 | 2e-21 | ||
| 1nw2_A | 105 | The Crystal Structure Of The Mutant R82e Of Thiored | 2e-21 | ||
| 1nsw_A | 105 | The Crystal Structure Of The K18g Mutant Of The Thi | 3e-21 | ||
| 3die_A | 106 | Domain Swapping Of Staphylococcus Aureus Thioredoxi | 3e-21 | ||
| 2gzy_A | 104 | Solution Structures Of The Reduced Form Of Thioredo | 5e-21 | ||
| 1quw_A | 105 | Solution Structure Of The Thioredoxin From Bacillus | 1e-20 | ||
| 3p2a_A | 148 | Crystal Structure Of Thioredoxin 2 From Yersinia Pe | 1e-20 | ||
| 2o89_A | 107 | S. Aureus Thioredoxin P31tC32S MUTANT Length = 107 | 2e-20 | ||
| 2ipa_A | 104 | Solution Structure Of Trx-Arsc Complex Length = 104 | 5e-20 | ||
| 2e0q_A | 104 | Crystal Structure Of K53e Thioredoxin From Sulfolob | 8e-20 | ||
| 2l5l_A | 136 | Solution Structure Of Thioredoxin From Bacteroides | 1e-19 | ||
| 3hhv_A | 110 | The Crystal Structure Of The Thioredoxin A2 From Su | 1e-19 | ||
| 2voc_A | 112 | Thioredoxin A Active Site Mutants Form Mixed Disulf | 2e-19 | ||
| 2l4q_A | 116 | Solution Structures Of Oxidized And Reduced Thiored | 2e-19 | ||
| 2i1u_A | 121 | Mycobacterium Tuberculosis Thioredoxin C Length = 1 | 4e-19 | ||
| 3hxs_A | 141 | Crystal Structure Of Bacteroides Fragilis Trxp Leng | 1e-18 | ||
| 3nof_A | 118 | Mycobacterium Tuberculosis Thioredoxin C C40s Mutan | 3e-18 | ||
| 2j23_A | 121 | Cross-Reactivity And Crystal Structure Of Malassezi | 3e-18 | ||
| 3hyp_A | 141 | Crystal Structure Of Bacteroides Fragilis Trxp_s105 | 3e-18 | ||
| 3tco_A | 109 | Crystallographic And Spectroscopic Characterization | 7e-18 | ||
| 1thx_A | 115 | Thioredoxin-2 Length = 115 | 8e-16 | ||
| 1m7t_A | 107 | Solution Structure And Dynamics Of The Human-Escher | 9e-16 | ||
| 1xwa_A | 111 | Drospohila Thioredoxin, Oxidized, P41212 Length = 1 | 7e-15 | ||
| 1xw9_A | 106 | Drospohila Thioredoxin, Oxidized, P21 Length = 106 | 1e-14 | ||
| 2ppt_A | 155 | Crystal Structure Of Thioredoxin-2 Length = 155 | 1e-14 | ||
| 2i9h_A | 103 | Nmr Solution Structure Of The Reduced Form Of Thior | 1e-14 | ||
| 3f3q_A | 109 | Crystal Structure Of The Oxidised Form Of Thioredox | 1e-14 | ||
| 2vm1_A | 118 | Crystal Structure Of Barley Thioredoxin H Isoform 1 | 4e-14 | ||
| 1uvz_A | 119 | Structure Of Human Thioredoxin 2 Length = 119 | 4e-14 | ||
| 3f3r_A | 109 | Crystal Structure Of Yeast Thioredoxin1-Glutathione | 1e-13 | ||
| 1syr_A | 112 | Initial Structural Analysis Of Plasmodium Falciparu | 1e-13 | ||
| 1wmj_A | 130 | Solution Structure Of Thioredoxin Type H From Oryza | 2e-13 | ||
| 1xfl_A | 124 | Solution Structure Of Thioredoxin H1 From Arabidops | 3e-13 | ||
| 2hsy_A | 104 | Solution Structure Of Thioredoxin 2 From Saccharomy | 3e-13 | ||
| 2fa4_A | 111 | Crystal Structure Of Oxidized Form From Saccharomyc | 3e-13 | ||
| 1x5d_A | 133 | The Solution Structure Of The Second Thioredoxin-Li | 9e-13 | ||
| 3qdn_A | 287 | Putative Thioredoxin Protein From Salmonella Typhim | 1e-12 | ||
| 2vlt_A | 122 | Crystal Structure Of Barley Thioredoxin H Isoform 2 | 3e-12 | ||
| 3pin_A | 104 | Crystal Structure Of Mxr1 From Saccharomyces Cerevi | 4e-12 | ||
| 4dss_B | 112 | Crystal Structure Of Peroxiredoxin Ahp1 From Saccha | 4e-12 | ||
| 3zzx_A | 105 | Crystallographic Structure Of Thioredoxin From Lito | 5e-12 | ||
| 3qou_A | 287 | Crystal Structure Of E. Coli Ybbn Length = 287 | 5e-12 | ||
| 1ep7_A | 112 | Crystal Structure Of Wt Thioredoxin H From Chlamydo | 6e-12 | ||
| 2xbi_A | 108 | Crystal Structure Of Schistosoma Mansoni Thioredoxi | 6e-12 | ||
| 2xbq_A | 117 | Crystal Structure Of Reduced Schistosoma Mansoni Th | 7e-12 | ||
| 1ep8_A | 112 | Crystal Structure Of A Mutated Thioredoxin, D30a, F | 1e-11 | ||
| 2iwt_A | 125 | Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfide Compl | 4e-11 | ||
| 2alb_A | 113 | Nmr Structure Of The N-Terminal Domain A Of The Gly | 7e-11 | ||
| 2vim_A | 104 | X-Ray Structure Of Fasciola Hepatica Thioredoxin Le | 9e-11 | ||
| 3gnj_A | 111 | The Crystal Structure Of A Thioredoxin-Related Prot | 2e-10 | ||
| 2dj3_A | 133 | The Solution Structure Of The Third Thioredoxin Dom | 2e-10 | ||
| 3m9j_A | 105 | Crystal Structure Of Human Thioredoxin C6973S DOUBL | 4e-10 | ||
| 3hz4_A | 140 | Crystal Structure Of Thioredoxin From Methanosarcin | 5e-10 | ||
| 2oe0_A | 114 | Crystal Structure Of Mitochondrial Thioredoxin 3 Fr | 6e-10 | ||
| 2hsh_A | 105 | Crystal Structure Of C73s Mutant Of Human Thioredox | 6e-10 | ||
| 1trs_A | 105 | The High-Resolution Three-Dimensional Solution Stru | 7e-10 | ||
| 1ti3_A | 113 | Solution Structure Of The Thioredoxin H1 From Popla | 8e-10 | ||
| 3kd0_A | 105 | Human Thioredoxin C35s,C62s,C69s,C73s Mutant Showin | 8e-10 | ||
| 2wz9_A | 153 | Crystal Structure Of The Thioredoxin Domain Of Huma | 1e-09 | ||
| 3f8u_A | 481 | TapasinERP57 HETERODIMER Length = 481 | 1e-09 | ||
| 1mek_A | 120 | Human Protein Disulfide Isomerase, Nmr, 40 Structur | 2e-09 | ||
| 2ifq_A | 105 | Crystal Structure Of S-Nitroso Thioredoxin Length = | 2e-09 | ||
| 2diy_A | 130 | The Solution Structure Of The Thioredoxin Domain Of | 2e-09 | ||
| 2ifq_B | 105 | Crystal Structure Of S-Nitroso Thioredoxin Length = | 3e-09 | ||
| 3trx_A | 105 | High-Resolution Three-Dimensional Structure Of Redu | 5e-09 | ||
| 3aps_A | 122 | Crystal Structure Of Trx4 Domain Of Erdj5 Length = | 5e-09 | ||
| 1mdi_A | 105 | High Resolution Solution Nmr Structure Of Mixed Dis | 6e-09 | ||
| 3vfi_A | 104 | Crystal Structure Of A Metagenomic Thioredoxin Leng | 7e-09 | ||
| 3qfa_C | 116 | Crystal Structure Of The Human Thioredoxin Reductas | 8e-09 | ||
| 1aiu_A | 105 | Human Thioredoxin (D60n Mutant, Reduced Form) Lengt | 9e-09 | ||
| 2dml_A | 130 | The Solution Structure Of The First Thioredoxin Dom | 3e-08 | ||
| 3d21_A | 139 | Crystal Structure Of A Poplar Wild-Type Thioredoxin | 3e-08 | ||
| 3e3e_A | 105 | Human Thioredoxin Double Mutant C35s,C73r Length = | 3e-08 | ||
| 2diz_A | 117 | The Solution Structure Of The Third Thioredoxin Dom | 4e-08 | ||
| 3uj1_A | 110 | Crystal Structure Of The Third Thioredoxin Domain O | 5e-08 | ||
| 3uvt_A | 111 | Crystal Structure Of The Third Catalytic Domain Of | 5e-08 | ||
| 3ul3_B | 128 | Structural Insights Into Thioredoxin-2: A Component | 6e-08 | ||
| 3d22_A | 139 | Crystal Structure Of A Poplar Thioredoxin H Mutant, | 1e-07 | ||
| 3idv_A | 241 | Crystal Structure Of The A0a Fragment Of Erp72 Leng | 1e-07 | ||
| 1f9m_A | 112 | Crystal Structure Of Thioredoxin F From Spinach Chl | 2e-07 | ||
| 1faa_A | 124 | Crystal Structure Of Thioredoxin F From Spinach Chl | 2e-07 | ||
| 3uem_A | 361 | Crystal Structure Of Human Pdi Bb'a' Domains Length | 3e-07 | ||
| 2dj2_A | 120 | The Solution Structure Of The Second Thioredoxin Do | 3e-07 | ||
| 1x5c_A | 121 | The Solution Structure Of The Second Thioredoxin-Li | 4e-07 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 4e-07 | ||
| 1erw_A | 105 | Human Thioredoxin Double Mutant With Cys 32 Replace | 6e-07 | ||
| 3ed3_A | 298 | Crystal Structure Of The Yeast DithiolDISULFIDE Oxi | 6e-07 | ||
| 2r2j_A | 382 | Crystal Structure Of Human Erp44 Length = 382 | 9e-07 | ||
| 2f51_A | 118 | Structure Of Trichomonas Vaginalis Thioredoxin Leng | 9e-07 | ||
| 2hxk_A | 105 | Crystal Structure Of S-Nitroso Thioredoxin Length = | 9e-07 | ||
| 2dj1_A | 140 | The Solution Structure Of The First Thioredoxin Dom | 2e-06 | ||
| 2pu9_C | 111 | Crystal Srtucture Of The Binary Complex Between Fer | 3e-06 | ||
| 1x5e_A | 126 | The Solution Structure Of The Thioredoxin-Like Doma | 6e-06 | ||
| 2djj_A | 121 | Solution Structure Of The A' Domain Of Thermophilic | 6e-06 | ||
| 2b5e_A | 504 | Crystal Structure Of Yeast Protein Disulfide Isomer | 2e-05 | ||
| 2dmm_A | 142 | The Solution Structure Of The Second Thioredoxin Do | 3e-05 | ||
| 3gl3_A | 152 | Crystal Structure Of A Putative Thiol:disulfide Int | 5e-05 | ||
| 1r26_A | 125 | Crystal Structure Of Thioredoxin From Trypanosoma B | 6e-05 | ||
| 1fo5_A | 85 | Solution Structure Of Reduced Mj0307 Length = 85 | 7e-05 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 1e-04 | ||
| 2lja_A | 152 | Solution Structure Of A Putative Thiol-Disulfide Ox | 2e-04 | ||
| 2g0f_A | 168 | Crystal Structure Of P144a Mutant Of E.Coli Ccmg Pr | 4e-04 | ||
| 3k8n_A | 185 | Crystal Structure Of E. Coli Ccmg Length = 185 | 4e-04 | ||
| 2b1l_A | 129 | Crystal Structure Of N-Terminal 57 Residue Deletion | 4e-04 | ||
| 2b1k_A | 168 | Crystal Structure Of E. Coli Ccmg Protein Length = | 5e-04 | ||
| 1a8l_A | 226 | Protein Disulfide Oxidoreductase From Archaeon Pyro | 8e-04 | ||
| 2dj0_A | 137 | The Solution Structure Of The Thioredoxin Domain Of | 8e-04 |
| >pdb|1FB0|A Chain A, Crystal Structure Of Thioredoxin M From Spinach Chloroplast (Reduced Form) Length = 105 | Back alignment and structure |
|
| >pdb|1GL8|A Chain A, Solution Structure Of Thioredoxin M From Spinach, Oxidized Form Length = 104 | Back alignment and structure |
| >pdb|2PUK|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin: Thioredoxin Reductase And Thioredoxin M Length = 106 | Back alignment and structure |
| >pdb|1DBY|A Chain A, Nmr Structures Of Chloroplast Thioredoxin M Ch2 From The Green Alga Chlamydomonas Reinhardtii Length = 107 | Back alignment and structure |
| >pdb|2YJ7|A Chain A, Crystal Structure Of A Hyperstable Protein From The Precambrian Period Length = 106 | Back alignment and structure |
| >pdb|2FCH|A Chain A, Crystal Structure Of Thioredoxin Mutant G74s Length = 108 | Back alignment and structure |
| >pdb|3DXB|A Chain A, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin Length = 222 | Back alignment and structure |
| >pdb|1ZZY|A Chain A, Crystal Structure Of Thioredoxin Mutant L7v Length = 108 | Back alignment and structure |
| >pdb|2H75|A Chain A, Crystal Structure Of Thioredoxin Mutant D13e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2H71|A Chain A, Crystal Structure Of Thioredoxin Mutant D47e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2H76|A Chain A, Crystal Structure Of Thioredoxin Mutant D10e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2H74|A Chain A, Crystal Structure Of Thioredoxin Mutant D2e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2TRX|A Chain A, Crystal Structure Of Thioredoxin From Escherichia Coli At 1.68 Angstroms Resolution Length = 108 | Back alignment and structure |
| >pdb|1XOB|A Chain A, Thioredoxin (Reduced Dithio Form), Nmr, 20 Structures Length = 108 | Back alignment and structure |
| >pdb|2EIO|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 | Back alignment and structure |
| >pdb|2H6Y|A Chain A, Crystal Structure Of Thioredoxin Mutant E48d In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2TIR|A Chain A, Crystal Structure Analysis Of A Mutant Escherichia Coli Thioredoxin In Which Lysine 36 Is Replaced By Glutamic Acid Length = 108 | Back alignment and structure |
| >pdb|2H6Z|A Chain A, Crystal Structure Of Thioredoxin Mutant E44d In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2H72|A Chain A, Crystal Structure Of Thioredoxin Mutant E85d In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2EIR|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 | Back alignment and structure |
| >pdb|3DYR|A Chain A, Crystal Structure Of E. Coli Thioredoxin Mutant I76t In Its Oxidized Form Length = 111 | Back alignment and structure |
| >pdb|2H70|A Chain A, Crystal Structure Of Thioredoxin Mutant D9e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2H73|A Chain A, Crystal Structure Of Thioredoxin Mutant D43e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2EIQ|A Chain A, Design Of Disulfide-linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 | Back alignment and structure |
| >pdb|2O8V|B Chain B, Paps Reductase In A Covalent Complex With Thioredoxin C35a Length = 128 | Back alignment and structure |
| >pdb|2FD3|A Chain A, Crystal Structure Of Thioredoxin Mutant P34h Length = 108 | Back alignment and structure |
| >pdb|1F6M|C Chain C, Crystal Structure Of A Complex Between Thioredoxin Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+ Length = 108 | Back alignment and structure |
| >pdb|1KEB|A Chain A, Crystal Structure Of Double Mutant M37l,P40s E.Coli Thioredoxin Length = 108 | Back alignment and structure |
| >pdb|1T00|A Chain A, The Structure Of Thioredoxin From S. Coelicolor Length = 112 | Back alignment and structure |
| >pdb|1THO|A Chain A, Crystal Structure Of A Mutant Escherichia Coli Thioredoxin With An Arginine Insertion In The Active Site Length = 109 | Back alignment and structure |
| >pdb|1V98|A Chain A, Crystal Structure Analysis Of Thioredoxin From Thermus Thermophilus Length = 140 | Back alignment and structure |
| >pdb|1TXX|A Chain A, Active-Site Variant Of E.Coli Thioredoxin Length = 108 | Back alignment and structure |
| >pdb|2O7K|A Chain A, S. Aureus Thioredoxin Length = 107 | Back alignment and structure |
| >pdb|2I4A|A Chain A, Crystal Structure Of Thioredoxin From The Acidophile Acetobacter Aceti Length = 107 | Back alignment and structure |
| >pdb|1SRX|A Chain A, Three-Dimensional Structure Of Escherichia Coli Thioredoxin-S2 To 2.8 Angstroms Resolution Length = 108 | Back alignment and structure |
| >pdb|1ZCP|A Chain A, Crystal Structure Of A Catalytic Site Mutant E. Coli Trxa (Caca) Length = 108 | Back alignment and structure |
| >pdb|1OAZ|A Chain A, Ige Fv Spe7 Complexed With A Recombinant Thioredoxin Length = 123 | Back alignment and structure |
| >pdb|2CVK|A Chain A, Crystal Structure Of Thermus Thermophilus Thioredoxin Length = 110 | Back alignment and structure |
| >pdb|2YZU|A Chain A, Crystal Structure Of Oxidized Thioredoxin From Thermus Thermophilus Hb8 Length = 109 | Back alignment and structure |
| >pdb|1RQM|A Chain A, Solution Structure Of The K18gR82E ALICYCLOBACILLUS Acidocaldarius Thioredoxin Mutant Length = 105 | Back alignment and structure |
| >pdb|2O87|A Chain A, S. Aureus Thioredoxin P31s Mutant Length = 106 | Back alignment and structure |
| >pdb|2O85|A Chain A, S. Aureus Thioredoxin P31t Mutant Length = 107 | Back alignment and structure |
| >pdb|1NW2|A Chain A, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius Length = 105 | Back alignment and structure |
| >pdb|1NSW|A Chain A, The Crystal Structure Of The K18g Mutant Of The Thioredoxin From Alicyclobacillus Acidocaldarius Length = 105 | Back alignment and structure |
| >pdb|3DIE|A Chain A, Domain Swapping Of Staphylococcus Aureus Thioredoxin W28a Mutant Length = 106 | Back alignment and structure |
| >pdb|2GZY|A Chain A, Solution Structures Of The Reduced Form Of Thioredoxin From Bacillus Subtilis Length = 104 | Back alignment and structure |
| >pdb|1QUW|A Chain A, Solution Structure Of The Thioredoxin From Bacillus Acidocaldarius Length = 105 | Back alignment and structure |
| >pdb|3P2A|A Chain A, Crystal Structure Of Thioredoxin 2 From Yersinia Pestis Length = 148 | Back alignment and structure |
| >pdb|2O89|A Chain A, S. Aureus Thioredoxin P31tC32S MUTANT Length = 107 | Back alignment and structure |
| >pdb|2IPA|A Chain A, Solution Structure Of Trx-Arsc Complex Length = 104 | Back alignment and structure |
| >pdb|2E0Q|A Chain A, Crystal Structure Of K53e Thioredoxin From Sulfolobus Tokodaii Strain7 Length = 104 | Back alignment and structure |
| >pdb|2L5L|A Chain A, Solution Structure Of Thioredoxin From Bacteroides Vulgatus Length = 136 | Back alignment and structure |
| >pdb|3HHV|A Chain A, The Crystal Structure Of The Thioredoxin A2 From Sulfolobus Solfataricus Length = 110 | Back alignment and structure |
| >pdb|2VOC|A Chain A, Thioredoxin A Active Site Mutants Form Mixed Disulfide Dimers That Resemble Enzyme-substrate Reaction Intermediate Length = 112 | Back alignment and structure |
| >pdb|2L4Q|A Chain A, Solution Structures Of Oxidized And Reduced Thioredoxin C From M. Tb Length = 116 | Back alignment and structure |
| >pdb|2I1U|A Chain A, Mycobacterium Tuberculosis Thioredoxin C Length = 121 | Back alignment and structure |
| >pdb|3HXS|A Chain A, Crystal Structure Of Bacteroides Fragilis Trxp Length = 141 | Back alignment and structure |
| >pdb|3NOF|A Chain A, Mycobacterium Tuberculosis Thioredoxin C C40s Mutant Length = 118 | Back alignment and structure |
| >pdb|2J23|A Chain A, Cross-Reactivity And Crystal Structure Of Malassezia Sympodialis Thioredoxin (Mala S 13), A Member Of A New Pan- Allergen Family Length = 121 | Back alignment and structure |
| >pdb|3HYP|A Chain A, Crystal Structure Of Bacteroides Fragilis Trxp_s105g Mutant Length = 141 | Back alignment and structure |
| >pdb|3TCO|A Chain A, Crystallographic And Spectroscopic Characterization Of Sulfolobus Solfataricus Trxa1 Provide Insights Into The Determinants Of Thioredoxin Fold Stability Length = 109 | Back alignment and structure |
| >pdb|1THX|A Chain A, Thioredoxin-2 Length = 115 | Back alignment and structure |
| >pdb|1M7T|A Chain A, Solution Structure And Dynamics Of The Human-Escherichia Coli Thioredoxin Chimera: Insights Into Thermodynamic Stability Length = 107 | Back alignment and structure |
| >pdb|1XWA|A Chain A, Drospohila Thioredoxin, Oxidized, P41212 Length = 111 | Back alignment and structure |
| >pdb|1XW9|A Chain A, Drospohila Thioredoxin, Oxidized, P21 Length = 106 | Back alignment and structure |
| >pdb|2PPT|A Chain A, Crystal Structure Of Thioredoxin-2 Length = 155 | Back alignment and structure |
| >pdb|2I9H|A Chain A, Nmr Solution Structure Of The Reduced Form Of Thioredoxin 1 From Yeast (Trx1) Length = 103 | Back alignment and structure |
| >pdb|3F3Q|A Chain A, Crystal Structure Of The Oxidised Form Of Thioredoxin 1 From Saccharomyces Cerevisiae Length = 109 | Back alignment and structure |
| >pdb|2VM1|A Chain A, Crystal Structure Of Barley Thioredoxin H Isoform 1 Crystallized Using Ammonium Sulfate As Precipitant Length = 118 | Back alignment and structure |
| >pdb|1UVZ|A Chain A, Structure Of Human Thioredoxin 2 Length = 119 | Back alignment and structure |
| >pdb|3F3R|A Chain A, Crystal Structure Of Yeast Thioredoxin1-Glutathione Mixed Disulfide Complex Length = 109 | Back alignment and structure |
| >pdb|1SYR|A Chain A, Initial Structural Analysis Of Plasmodium Falciparum Thioredoxin Length = 112 | Back alignment and structure |
| >pdb|1WMJ|A Chain A, Solution Structure Of Thioredoxin Type H From Oryza Sativa Length = 130 | Back alignment and structure |
| >pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Arabidopsis Thaliana Length = 124 | Back alignment and structure |
| >pdb|2HSY|A Chain A, Solution Structure Of Thioredoxin 2 From Saccharomyces Cerevisiae Length = 104 | Back alignment and structure |
| >pdb|2FA4|A Chain A, Crystal Structure Of Oxidized Form From Saccharomyces Cerevisiae Length = 111 | Back alignment and structure |
| >pdb|1X5D|A Chain A, The Solution Structure Of The Second Thioredoxin-Like Domain Of Human Protein Disulfide-Isomerase A6 Length = 133 | Back alignment and structure |
| >pdb|3QDN|A Chain A, Putative Thioredoxin Protein From Salmonella Typhimurium Length = 287 | Back alignment and structure |
| >pdb|2VLT|A Chain A, Crystal Structure Of Barley Thioredoxin H Isoform 2 In The Oxidized State Length = 122 | Back alignment and structure |
| >pdb|3PIN|A Chain A, Crystal Structure Of Mxr1 From Saccharomyces Cerevisiae In Complex With Trx2 Length = 104 | Back alignment and structure |
| >pdb|4DSS|B Chain B, Crystal Structure Of Peroxiredoxin Ahp1 From Saccharomyces Cerevisiae In Complex With Thioredoxin Trx2 Length = 112 | Back alignment and structure |
| >pdb|3ZZX|A Chain A, Crystallographic Structure Of Thioredoxin From Litopenaeus Vannamei Length = 105 | Back alignment and structure |
| >pdb|3QOU|A Chain A, Crystal Structure Of E. Coli Ybbn Length = 287 | Back alignment and structure |
| >pdb|1EP7|A Chain A, Crystal Structure Of Wt Thioredoxin H From Chlamydomonas Reinhardtii Length = 112 | Back alignment and structure |
| >pdb|2XBI|A Chain A, Crystal Structure Of Schistosoma Mansoni Thioredoxin At 1.6 Angstrom Length = 108 | Back alignment and structure |
| >pdb|2XBQ|A Chain A, Crystal Structure Of Reduced Schistosoma Mansoni Thioredoxin Pre-Protein At 1.7 Angstrom Length = 117 | Back alignment and structure |
| >pdb|1EP8|A Chain A, Crystal Structure Of A Mutated Thioredoxin, D30a, From Chlamydomonas Reinhardtii Length = 112 | Back alignment and structure |
| >pdb|2IWT|A Chain A, Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfide Complex With The Target Protein Basi Length = 125 | Back alignment and structure |
| >pdb|2ALB|A Chain A, Nmr Structure Of The N-Terminal Domain A Of The Glycoprotein Chaperone Erp57 Length = 113 | Back alignment and structure |
| >pdb|2VIM|A Chain A, X-Ray Structure Of Fasciola Hepatica Thioredoxin Length = 104 | Back alignment and structure |
| >pdb|3GNJ|A Chain A, The Crystal Structure Of A Thioredoxin-Related Protein From Desulfitobacterium Hafniense Dcb Length = 111 | Back alignment and structure |
| >pdb|2DJ3|A Chain A, The Solution Structure Of The Third Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 133 | Back alignment and structure |
| >pdb|3M9J|A Chain A, Crystal Structure Of Human Thioredoxin C6973S DOUBLE MUTANT, REDUCED Form Length = 105 | Back alignment and structure |
| >pdb|3HZ4|A Chain A, Crystal Structure Of Thioredoxin From Methanosarcina Mazei Length = 140 | Back alignment and structure |
| >pdb|2OE0|A Chain A, Crystal Structure Of Mitochondrial Thioredoxin 3 From Saccharomyces Cerevisiae Length = 114 | Back alignment and structure |
| >pdb|2HSH|A Chain A, Crystal Structure Of C73s Mutant Of Human Thioredoxin-1 Oxidized With H2o2 Length = 105 | Back alignment and structure |
| >pdb|1TRS|A Chain A, The High-Resolution Three-Dimensional Solution Structures Of The Oxidized And Reduced States Of Human Thioredoxin Length = 105 | Back alignment and structure |
| >pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 From Poplar, A Cppc Active Site Variant Length = 113 | Back alignment and structure |
| >pdb|3KD0|A Chain A, Human Thioredoxin C35s,C62s,C69s,C73s Mutant Showing Cadmium Chloride Bound To The Active Site Length = 105 | Back alignment and structure |
| >pdb|2WZ9|A Chain A, Crystal Structure Of The Thioredoxin Domain Of Human Txnl2 Length = 153 | Back alignment and structure |
| >pdb|3F8U|A Chain A, TapasinERP57 HETERODIMER Length = 481 | Back alignment and structure |
| >pdb|1MEK|A Chain A, Human Protein Disulfide Isomerase, Nmr, 40 Structures Length = 120 | Back alignment and structure |
| >pdb|2IFQ|A Chain A, Crystal Structure Of S-Nitroso Thioredoxin Length = 105 | Back alignment and structure |
| >pdb|2DIY|A Chain A, The Solution Structure Of The Thioredoxin Domain Of Human Thioredoxin-Like Protein 2 Length = 130 | Back alignment and structure |
| >pdb|2IFQ|B Chain B, Crystal Structure Of S-Nitroso Thioredoxin Length = 105 | Back alignment and structure |
| >pdb|3TRX|A Chain A, High-Resolution Three-Dimensional Structure Of Reduced Recombinant Human Thioredoxin In Solution Length = 105 | Back alignment and structure |
| >pdb|3APS|A Chain A, Crystal Structure Of Trx4 Domain Of Erdj5 Length = 122 | Back alignment and structure |
| >pdb|1MDI|A Chain A, High Resolution Solution Nmr Structure Of Mixed Disulfide Intermediate Between Mutant Human Thioredoxin And A 13 Residue Peptide Comprising Its Target Site In Human Nfkb Length = 105 | Back alignment and structure |
| >pdb|3VFI|A Chain A, Crystal Structure Of A Metagenomic Thioredoxin Length = 104 | Back alignment and structure |
| >pdb|3QFA|C Chain C, Crystal Structure Of The Human Thioredoxin Reductase-Thioredoxin Complex Length = 116 | Back alignment and structure |
| >pdb|1AIU|A Chain A, Human Thioredoxin (D60n Mutant, Reduced Form) Length = 105 | Back alignment and structure |
| >pdb|2DML|A Chain A, The Solution Structure Of The First Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A6 Length = 130 | Back alignment and structure |
| >pdb|3D21|A Chain A, Crystal Structure Of A Poplar Wild-Type Thioredoxin H, Pttrxh4 Length = 139 | Back alignment and structure |
| >pdb|3E3E|A Chain A, Human Thioredoxin Double Mutant C35s,C73r Length = 105 | Back alignment and structure |
| >pdb|2DIZ|A Chain A, The Solution Structure Of The Third Thioredoxin Domain Of Human Thioredoxin Domain-Containing Protein 5 Length = 117 | Back alignment and structure |
| >pdb|3UJ1|A Chain A, Crystal Structure Of The Third Thioredoxin Domain Of Human Erp46 Length = 110 | Back alignment and structure |
| >pdb|3UVT|A Chain A, Crystal Structure Of The Third Catalytic Domain Of Erp46 Length = 111 | Back alignment and structure |
| >pdb|3UL3|B Chain B, Structural Insights Into Thioredoxin-2: A Component Of Malaria Parasite Protein Secretion Machinery Length = 128 | Back alignment and structure |
| >pdb|3D22|A Chain A, Crystal Structure Of A Poplar Thioredoxin H Mutant, Pttrxh4c61s Length = 139 | Back alignment and structure |
| >pdb|3IDV|A Chain A, Crystal Structure Of The A0a Fragment Of Erp72 Length = 241 | Back alignment and structure |
| >pdb|1F9M|A Chain A, Crystal Structure Of Thioredoxin F From Spinach Chloroplast (Short Form) Length = 112 | Back alignment and structure |
| >pdb|1FAA|A Chain A, Crystal Structure Of Thioredoxin F From Spinach Chloroplast (Long Form) Length = 124 | Back alignment and structure |
| >pdb|3UEM|A Chain A, Crystal Structure Of Human Pdi Bb'a' Domains Length = 361 | Back alignment and structure |
| >pdb|2DJ2|A Chain A, The Solution Structure Of The Second Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 120 | Back alignment and structure |
| >pdb|1X5C|A Chain A, The Solution Structure Of The Second Thioredoxin-Like Domain Of Human Protein Disulfide-Isomerase Length = 121 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|1ERW|A Chain A, Human Thioredoxin Double Mutant With Cys 32 Replaced By Ser And Cys 35 Replaced By Ser Length = 105 | Back alignment and structure |
| >pdb|3ED3|A Chain A, Crystal Structure Of The Yeast DithiolDISULFIDE Oxidoreductase Mpd1p Length = 298 | Back alignment and structure |
| >pdb|2R2J|A Chain A, Crystal Structure Of Human Erp44 Length = 382 | Back alignment and structure |
| >pdb|2F51|A Chain A, Structure Of Trichomonas Vaginalis Thioredoxin Length = 118 | Back alignment and structure |
| >pdb|2HXK|A Chain A, Crystal Structure Of S-Nitroso Thioredoxin Length = 105 | Back alignment and structure |
| >pdb|2DJ1|A Chain A, The Solution Structure Of The First Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 140 | Back alignment and structure |
| >pdb|2PU9|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin: Thioredoxin Reductase And Thioredoxin F Length = 111 | Back alignment and structure |
| >pdb|1X5E|A Chain A, The Solution Structure Of The Thioredoxin-Like Domain Of Human Thioredoxin-Related Transmembrane Protein Length = 126 | Back alignment and structure |
| >pdb|2DJJ|A Chain A, Solution Structure Of The A' Domain Of Thermophilic Fungal Protein Disulfide Isomerase Length = 121 | Back alignment and structure |
| >pdb|2B5E|A Chain A, Crystal Structure Of Yeast Protein Disulfide Isomerase Length = 504 | Back alignment and structure |
| >pdb|2DMM|A Chain A, The Solution Structure Of The Second Thioredoxin Domain Of Human Protein Disulfide-Isomerase A3 Length = 142 | Back alignment and structure |
| >pdb|3GL3|A Chain A, Crystal Structure Of A Putative Thiol:disulfide Interchange Protein Dsbe From Chlorobium Tepidum Length = 152 | Back alignment and structure |
| >pdb|1R26|A Chain A, Crystal Structure Of Thioredoxin From Trypanosoma Brucei Brucei Length = 125 | Back alignment and structure |
| >pdb|1FO5|A Chain A, Solution Structure Of Reduced Mj0307 Length = 85 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|2LJA|A Chain A, Solution Structure Of A Putative Thiol-Disulfide Oxidoreductase From Bacteroides Vulgatus Length = 152 | Back alignment and structure |
| >pdb|2G0F|A Chain A, Crystal Structure Of P144a Mutant Of E.Coli Ccmg Protein Length = 168 | Back alignment and structure |
| >pdb|2B1L|A Chain A, Crystal Structure Of N-Terminal 57 Residue Deletion Mutant Of E. Coli Ccmg Protein(Residues 58-185) Length = 129 | Back alignment and structure |
| >pdb|2B1K|A Chain A, Crystal Structure Of E. Coli Ccmg Protein Length = 168 | Back alignment and structure |
| >pdb|1A8L|A Chain A, Protein Disulfide Oxidoreductase From Archaeon Pyrococcus Furiosus Length = 226 | Back alignment and structure |
| >pdb|2DJ0|A Chain A, The Solution Structure Of The Thioredoxin Domain Of Human Thioredoxin-Related Transmembrane Protein 2 Length = 137 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 186 | |||
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 4e-65 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 1e-63 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 1e-61 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 1e-60 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 3e-60 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 6e-60 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 1e-59 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 1e-59 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 4e-59 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 1e-58 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 1e-58 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 3e-57 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 3e-57 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 3e-57 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 3e-57 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 2e-56 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 3e-56 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 3e-56 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 4e-56 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 4e-56 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 5e-56 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 5e-56 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 2e-55 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 3e-55 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 1e-54 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 3e-54 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 7e-53 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 3e-51 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 6e-49 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 1e-47 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 5e-47 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 9e-47 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 1e-46 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 2e-45 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 2e-45 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 2e-45 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 7e-45 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 1e-44 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 1e-44 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 1e-44 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 5e-44 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 2e-43 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 2e-43 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 8e-43 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 1e-42 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 1e-42 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 1e-41 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 4e-41 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 5e-41 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 1e-40 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 1e-40 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 5e-40 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 5e-40 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 5e-40 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 6e-40 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 9e-40 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 2e-39 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 9e-39 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 3e-37 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 3e-36 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 7e-35 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 8e-35 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 2e-28 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 8e-28 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 9e-28 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 3e-27 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 1e-26 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 1e-25 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 1e-24 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 9e-24 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 4e-23 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 5e-23 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 4e-22 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 2e-21 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 2e-21 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 3e-21 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 7e-17 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 1e-20 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 3e-19 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 2e-16 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 3e-16 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 7e-09 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 4e-20 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 5e-20 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 2e-16 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 9e-20 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 1e-19 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 1e-18 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 6e-18 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 2e-18 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 7e-18 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 1e-17 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 1e-17 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 4e-17 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 5e-17 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 6e-17 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 8e-17 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 9e-17 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 4e-06 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 1e-16 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 2e-16 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 2e-16 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 3e-16 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 5e-16 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 7e-16 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 8e-16 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 8e-16 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 2e-15 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 3e-15 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 3e-15 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 5e-15 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 5e-15 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 6e-15 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 3e-14 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 5e-14 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 7e-14 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 8e-14 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 2e-13 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 2e-13 | |
| 4fo5_A | 143 | Thioredoxin-like protein; AHPC/TSA family protein, | 3e-13 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 4e-13 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 6e-13 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 8e-13 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 1e-12 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 2e-12 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 3e-12 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 5e-12 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 7e-12 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 8e-12 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 8e-12 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 1e-11 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 1e-11 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 1e-11 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 2e-11 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 2e-11 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 2e-11 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 5e-11 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 7e-11 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 8e-11 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 9e-11 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 3e-10 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 1e-10 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 2e-10 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 7e-10 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 2e-09 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 1e-08 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 3e-08 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 5e-08 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 7e-08 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 9e-08 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 1e-07 | |
| 2c0g_A | 248 | ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, | 5e-07 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 1e-06 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 2e-06 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 3e-04 | |
| 3ga4_A | 178 | Dolichyl-diphosphooligosaccharide-protein glycosyl | 8e-04 |
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Length = 105 | Back alignment and structure |
|---|
Score = 194 bits (495), Expect = 4e-65
Identities = 69/105 (65%), Positives = 90/105 (85%)
Query: 82 EVPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDE 141
EV V D++W+ VL+S PV+V+FWAPWCGPC++I P+IDEL+K+Y GK+ YK+NTDE
Sbjct: 1 EVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDE 60
Query: 142 SPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL 186
+P IAT+Y IRSIPTV+ FKNGE+K+++IGAVPKSTLT SIEK+L
Sbjct: 61 APGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL 105
|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Length = 107 | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Length = 140 | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Length = 106 | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Length = 140 | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} Length = 111 | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Length = 136 | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Length = 112 | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} Length = 109 | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Length = 108 | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Length = 115 | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Length = 148 | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Length = 128 | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Length = 109 | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Length = 128 | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Length = 107 | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Length = 155 | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Length = 106 | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Length = 105 | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Length = 121 | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Length = 104 | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Length = 141 | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Length = 121 | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Length = 119 | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Length = 112 | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Length = 123 | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Length = 135 | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Length = 122 | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Length = 114 | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Length = 112 | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Length = 142 | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Length = 110 | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Length = 124 | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Length = 125 | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Length = 111 | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Length = 109 | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Length = 106 | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Length = 85 | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Length = 118 | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Length = 124 | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Length = 153 | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Length = 126 | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Length = 104 | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Length = 112 | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Length = 117 | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Length = 130 | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Length = 118 | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Length = 107 | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Length = 112 | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Length = 122 | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Length = 105 | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Length = 113 | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Length = 116 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Length = 105 | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Length = 130 | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Length = 139 | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Length = 133 | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} PDB: 1xbs_A Length = 149 | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Length = 85 | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Length = 226 | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 135 | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 133 | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} Length = 127 | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Length = 298 | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Length = 245 | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Length = 137 | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A Length = 111 | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Length = 120 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Length = 134 | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Length = 121 | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 140 | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Length = 217 | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Length = 361 | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Length = 118 | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Length = 519 | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Length = 153 | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Length = 151 | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Length = 148 | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Length = 164 | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Length = 240 | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Length = 152 | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Length = 136 | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Length = 138 | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Length = 136 | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Length = 152 | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} Length = 145 | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Length = 158 | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Length = 154 | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Length = 154 | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} Length = 165 | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Length = 470 | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Length = 148 | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Length = 352 | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Length = 130 | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Length = 152 | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Length = 152 | Back alignment and structure |
|---|
| >4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Length = 143 | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Length = 151 | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Length = 148 | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Length = 183 | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Length = 164 | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Length = 140 | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Length = 142 | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Length = 146 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Length = 144 | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Length = 143 | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Length = 142 | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Length = 165 | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Length = 150 | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Length = 144 | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Length = 160 | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Length = 159 | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Length = 133 | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Length = 165 | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Length = 123 | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Length = 229 | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Length = 229 | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Length = 158 | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Length = 160 | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Length = 186 | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Length = 167 | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Length = 168 | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Length = 176 | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Length = 153 | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Length = 156 | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Length = 116 | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Length = 243 | Back alignment and structure |
|---|
| >2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Length = 248 | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Length = 154 | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Length = 172 | Back alignment and structure |
|---|
| >3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Length = 178 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 186 | |||
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 99.96 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 99.95 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 99.95 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 99.94 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 99.93 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 99.93 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 99.93 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 99.93 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 99.93 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 99.93 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 99.93 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 99.92 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 99.92 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 99.92 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 99.92 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 99.92 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 99.92 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 99.92 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 99.92 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 99.92 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 99.92 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 99.92 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 99.92 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 99.91 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 99.91 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 99.91 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 99.91 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 99.91 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 99.91 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 99.91 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 99.91 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.91 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 99.91 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 99.91 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 99.91 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 99.91 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 99.91 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 99.91 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 99.9 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 99.9 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 99.9 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 99.9 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 99.9 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 99.9 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 99.9 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 99.9 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.9 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 99.9 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 99.9 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 99.9 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 99.9 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 99.9 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 99.9 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.9 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 99.9 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 99.89 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 99.89 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 99.89 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 99.89 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 99.89 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 99.89 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 99.89 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 99.89 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 99.88 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 99.88 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 99.88 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 99.88 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.88 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 99.88 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 99.88 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.87 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 99.87 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 99.87 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 99.87 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 99.87 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 99.79 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 99.86 | |
| 3ga4_A | 178 | Dolichyl-diphosphooligosaccharide-protein glycosyl | 99.86 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.85 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 99.85 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 99.85 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 99.84 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 99.84 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 99.84 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 99.84 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 99.84 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 99.83 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 99.83 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 99.83 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.83 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 99.83 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 99.82 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 99.82 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 99.82 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 99.82 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 99.82 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 99.82 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 99.81 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 99.81 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 99.81 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 99.8 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 99.8 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 99.8 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 99.8 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 99.67 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 99.79 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 99.79 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 99.79 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 99.78 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 99.78 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 99.78 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.78 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 99.77 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 99.77 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 99.77 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 99.77 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 99.77 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 99.77 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 99.77 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 99.77 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 99.77 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 99.76 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 99.76 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 99.76 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 99.75 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 99.75 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.75 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 99.75 | |
| 3ira_A | 173 | Conserved protein; methanosarcina mazei,structural | 99.75 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 99.75 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 99.75 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 99.75 | |
| 2c0g_A | 248 | ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, | 99.74 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 99.74 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 99.74 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 99.74 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 99.74 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 99.73 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 99.73 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 99.73 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 99.72 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 99.72 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 99.71 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 99.71 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 99.71 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 99.71 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 99.71 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 99.7 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 99.7 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 99.7 | |
| 2ywi_A | 196 | Hypothetical conserved protein; uncharacterized co | 99.7 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 99.7 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 99.69 | |
| 2cvb_A | 188 | Probable thiol-disulfide isomerase/thioredoxin; re | 99.69 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 99.68 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 99.68 | |
| 4fo5_A | 143 | Thioredoxin-like protein; AHPC/TSA family protein, | 99.67 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 99.66 | |
| 2vup_A | 190 | Glutathione peroxidase-like protein; oxidoreductas | 99.66 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 99.66 | |
| 2k6v_A | 172 | Putative cytochrome C oxidase assembly protein; th | 99.66 | |
| 2ggt_A | 164 | SCO1 protein homolog, mitochondrial; copper chaper | 99.66 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 99.66 | |
| 3u5r_E | 218 | Uncharacterized protein; structural genomics, PSI- | 99.65 | |
| 2p31_A | 181 | CL683, glutathione peroxidase 7; thioredoxin fold, | 99.65 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 99.65 | |
| 3cmi_A | 171 | Peroxiredoxin HYR1; thioredoxin-like fold, oxidore | 99.65 | |
| 2rli_A | 171 | SCO2 protein homolog, mitochondrial; copper protei | 99.65 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 99.64 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 99.64 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 99.43 | |
| 2p5q_A | 170 | Glutathione peroxidase 5; thioredoxin fold, oxidor | 99.62 | |
| 3dwv_A | 187 | Glutathione peroxidase-like protein; alpha beta, 3 | 99.62 | |
| 3drn_A | 161 | Peroxiredoxin, bacterioferritin comigratory prote | 99.62 | |
| 2v1m_A | 169 | Glutathione peroxidase; selenium, selenocysteine, | 99.62 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 99.4 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 99.6 | |
| 2obi_A | 183 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 99.58 | |
| 2f8a_A | 208 | Glutathione peroxidase 1; thioredoxin fold, struct | 99.57 | |
| 1we0_A | 187 | Alkyl hydroperoxide reductase C; peroxiredoxin, AH | 99.57 | |
| 3kij_A | 180 | Probable glutathione peroxidase 8; human PDI-perox | 99.57 | |
| 1xvw_A | 160 | Hypothetical protein RV2238C/MT2298; thioredoxin f | 99.57 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 99.57 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 99.56 | |
| 1zof_A | 198 | Alkyl hydroperoxide-reductase; decamer, toroide-sh | 99.56 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 99.55 | |
| 2gs3_A | 185 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 99.55 | |
| 2bmx_A | 195 | Alkyl hydroperoxidase C; peroxiredoxin, antioxidan | 99.54 | |
| 1xzo_A | 174 | BSSCO, hypothetical protein YPMQ; thioredoxin-like | 99.54 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 99.53 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 99.52 | |
| 2jsy_A | 167 | Probable thiol peroxidase; solution structure, ant | 99.51 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 99.5 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 99.49 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 99.49 | |
| 2h01_A | 192 | 2-Cys peroxiredoxin; thioredoxin peroxidase, struc | 99.48 | |
| 1xvq_A | 175 | Thiol peroxidase; thioredoxin fold, structural gen | 99.48 | |
| 1qmv_A | 197 | Human thioredoxin peroxidase-B; peroxiredoxin, sul | 99.47 | |
| 1uul_A | 202 | Tryparedoxin peroxidase homologue; peroxiredoxin, | 99.47 | |
| 2b7k_A | 200 | SCO1 protein; metallochaperone, cytochrome C oxida | 99.47 | |
| 2i81_A | 213 | 2-Cys peroxiredoxin; structural genomics consortiu | 99.46 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 99.44 | |
| 2a4v_A | 159 | Peroxiredoxin DOT5; yeast nuclear thiol peroxidase | 99.43 | |
| 3gkn_A | 163 | Bacterioferritin comigratory protein; BCP, PRX, at | 99.43 | |
| 1zye_A | 220 | Thioredoxin-dependent peroxide reductase; catenane | 99.43 | |
| 2i3y_A | 215 | Epididymal secretory glutathione peroxidase; thior | 99.43 | |
| 3ztl_A | 222 | Thioredoxin peroxidase; oxidoreductase, reductase, | 99.39 | |
| 2r37_A | 207 | Glutathione peroxidase 3; plasma, structural genom | 99.39 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 99.39 | |
| 4g2e_A | 157 | Peroxiredoxin; redox protein, structural genomics, | 99.38 | |
| 3ixr_A | 179 | Bacterioferritin comigratory protein; alpha beta p | 99.34 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 99.33 | |
| 1q98_A | 165 | Thiol peroxidase, TPX; structural genomics, NYSGXR | 99.32 | |
| 1psq_A | 163 | Probable thiol peroxidase; structural genomics, NY | 99.32 | |
| 2c0d_A | 221 | Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th | 99.31 | |
| 3me7_A | 170 | Putative uncharacterized protein; electron transfe | 99.31 | |
| 2yzh_A | 171 | Probable thiol peroxidase; redox protein, antioxid | 99.28 | |
| 1n8j_A | 186 | AHPC, alkyl hydroperoxide reductase C22 protein; p | 99.27 | |
| 3hd5_A | 195 | Thiol:disulfide interchange protein DSBA; protein | 99.26 | |
| 4gqc_A | 164 | Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f | 99.26 | |
| 3uma_A | 184 | Hypothetical peroxiredoxin protein; nysgrc, PSI bi | 99.26 | |
| 3p7x_A | 166 | Probable thiol peroxidase; thioredoxin fold, oxido | 99.25 | |
| 3zrd_A | 200 | Thiol peroxidase; oxidoreductase, 2Cys peroxiredox | 99.24 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 99.23 | |
| 2pn8_A | 211 | Peroxiredoxin-4; thioredoxin, oxidoreductase, stru | 99.21 | |
| 1tp9_A | 162 | Peroxiredoxin, PRX D (type II); oligomer, thioredo | 99.2 | |
| 2wfc_A | 167 | Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan | 99.2 | |
| 3a2v_A | 249 | Probable peroxiredoxin; thioredoxin peroxidase, hy | 99.2 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 99.18 | |
| 3qpm_A | 240 | Peroxiredoxin; oxidoreductase, thioredoxin fold, p | 99.17 | |
| 3gv1_A | 147 | Disulfide interchange protein; neisseria gonorrhoe | 99.17 | |
| 4hde_A | 170 | SCO1/SENC family lipoprotein; structural genomics, | 99.16 | |
| 2znm_A | 195 | Thiol:disulfide interchange protein DSBA; thioredo | 99.15 | |
| 3mng_A | 173 | Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, | 99.14 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 99.14 | |
| 2pwj_A | 171 | Mitochondrial peroxiredoxin; alpha and beta protei | 99.14 | |
| 4f9z_D | 227 | Endoplasmic reticulum resident protein 27; thiored | 99.14 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 99.12 | |
| 3hz8_A | 193 | Thiol:disulfide interchange protein DSBA; thiol-ox | 99.12 | |
| 3tjj_A | 254 | Peroxiredoxin-4; thioredoxin fold, sulfenylation, | 99.09 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 99.08 | |
| 4dvc_A | 184 | Thiol:disulfide interchange protein DSBA; pilus as | 99.07 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 99.07 | |
| 1z6m_A | 175 | Conserved hypothetical protein; structural genomic | 99.06 | |
| 2rem_A | 193 | Disulfide oxidoreductase; disulfide oxidoreductase | 99.02 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 99.01 | |
| 1prx_A | 224 | HORF6; peroxiredoxin, hydrogen peroxide, redox reg | 98.97 | |
| 3l9v_A | 189 | Putative thiol-disulfide isomerase or thioredoxin; | 98.97 | |
| 2v2g_A | 233 | Peroxiredoxin 6; oxidoreductase, antioxidant enzym | 98.95 | |
| 1xcc_A | 220 | 1-Cys peroxiredoxin; unknown function, structural | 98.92 | |
| 3keb_A | 224 | Probable thiol peroxidase; structural genomics, AP | 98.92 | |
| 3feu_A | 185 | Putative lipoprotein; alpha-beta structure, struct | 98.92 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 98.91 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 98.85 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 98.84 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 98.83 | |
| 3l9s_A | 191 | Thiol:disulfide interchange protein; thioredoxin-f | 98.77 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 98.76 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 98.75 | |
| 2l4c_A | 124 | Endoplasmic reticulum resident protein 27; ERP27, | 98.74 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 98.73 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 98.72 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 98.7 | |
| 2ec4_A | 178 | FAS-associated factor 1; UAS domain, protein FAF1, | 98.68 | |
| 1un2_A | 197 | DSBA, thiol-disulfide interchange protein; disulfi | 98.67 | |
| 4eo3_A | 322 | Bacterioferritin comigratory protein/NADH dehydro; | 98.64 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 98.63 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 98.62 | |
| 3sbc_A | 216 | Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c | 98.62 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 98.52 | |
| 3gha_A | 202 | Disulfide bond formation protein D; BDBD, DSBA-lik | 98.5 | |
| 4f82_A | 176 | Thioredoxin reductase; structural genomics, niaid, | 98.49 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 98.45 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 98.42 | |
| 3f4s_A | 226 | Alpha-DSBA1, putative uncharacterized protein; thi | 98.41 | |
| 3tue_A | 219 | Tryparedoxin peroxidase; thioredoxin fold, peroxir | 98.41 | |
| 3bj5_A | 147 | Protein disulfide-isomerase; thioredoxin fold, cha | 98.39 | |
| 4f9z_D | 227 | Endoplasmic reticulum resident protein 27; thiored | 98.37 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 98.3 | |
| 3c7m_A | 195 | Thiol:disulfide interchange protein DSBA-like; red | 98.26 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 98.24 | |
| 3bci_A | 186 | Disulfide bond protein A; thiol-disulfide oxidored | 98.23 | |
| 2in3_A | 216 | Hypothetical protein; DSBA family, FRNE-like subfa | 98.15 | |
| 3kzq_A | 208 | Putative uncharacterized protein VP2116; protein w | 98.15 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 98.14 | |
| 3tdg_A | 273 | DSBG, putative uncharacterized protein; thioredoxi | 98.14 | |
| 2h8l_A | 252 | Protein disulfide-isomerase A3; thioredoxin-like f | 98.11 | |
| 2h8l_A | 252 | Protein disulfide-isomerase A3; thioredoxin-like f | 98.09 | |
| 3gmf_A | 205 | Protein-disulfide isomerase; oxidoreductase, PSI-2 | 98.04 | |
| 3gn3_A | 182 | Putative protein-disulfide isomerase; MCSG, PSI, s | 97.99 | |
| 1xiy_A | 182 | Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin | 97.91 | |
| 3ec3_A | 250 | Protein disulfide-isomerase A4; thioredoxin-like f | 97.88 | |
| 3ec3_A | 250 | Protein disulfide-isomerase A4; thioredoxin-like f | 97.86 | |
| 2xhf_A | 171 | Peroxiredoxin 5; oxidoreductase, antioxidant enzym | 97.83 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 97.79 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 97.78 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 97.77 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 97.7 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 97.69 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 97.69 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 97.68 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 97.67 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 97.59 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 97.57 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 97.56 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 97.35 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 96.99 | |
| 2imf_A | 203 | HCCA isomerase, 2-hydroxychromene-2-carboxylate is | 96.86 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 96.38 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 96.26 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 96.12 | |
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 96.12 | |
| 1t4y_A | 105 | Adaptive-response sensory-kinase SASA; alpha/beta | 95.91 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 95.73 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 95.5 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 94.9 | |
| 3ktb_A | 106 | Arsenical resistance operon trans-acting represso; | 94.17 | |
| 3gl5_A | 239 | Putative DSBA oxidoreductase SCO1869; probable DSB | 93.36 | |
| 3kgk_A | 110 | Arsenical resistance operon trans-acting represso; | 92.96 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 92.89 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 92.81 | |
| 1r4w_A | 226 | Glutathione S-transferase, mitochondrial; glutathi | 91.51 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 91.3 | |
| 3fz5_A | 202 | Possible 2-hydroxychromene-2-carboxylate isomeras; | 90.88 | |
| 2g2q_A | 124 | Glutaredoxin-2; thioredoxin-fold, oxidoreductase, | 89.4 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 88.51 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 86.66 | |
| 3rpp_A | 234 | Glutathione S-transferase kappa 1; glutathione tra | 86.3 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 83.71 | |
| 4g9p_A | 406 | 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; | 83.62 | |
| 1wwj_A | 105 | Circadian clock protein KAIB; 1.90A {Synechocystis | 82.56 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 81.73 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 81.6 |
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
Probab=99.96 E-value=4.8e-29 Score=181.14 Aligned_cols=110 Identities=16% Similarity=0.258 Sum_probs=98.7
Q ss_pred ccccccccccChhHHHHHHHhCCCcEEEEEECCCC--cccccchHHHHHHHHHhcCceEEEEEeCCCChHHHHHcCCCcc
Q 029866 77 QETAVEVPAVTDATWQSLVLDSGSPVLVEFWAPWC--GPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSI 154 (186)
Q Consensus 77 ~~~~~~v~~l~~~~~~~~~~~~~k~vvv~F~a~wC--~~C~~~~p~l~~l~~~~~~~v~~~~v~~d~~~~l~~~~~i~~~ 154 (186)
.......+.+++++|++.+...++++||+||++|| ++|+++.|.+++++++|.++++|+++|+|++++++.+|||+++
T Consensus 11 l~~~~g~~~vt~~~F~~~v~~~~~~vlVdF~A~wCr~gpCk~iaPvleela~e~~~~v~~~KVdvDe~~~la~~ygV~si 90 (137)
T 2qsi_A 11 AARPNAPTLVDEATVDDFIAHSGKIVVLFFRGDAVRFPEAADLAVVLPELINAFPGRLVAAEVAAEAERGLMARFGVAVC 90 (137)
T ss_dssp ------CEEECTTTHHHHHHTSSSEEEEEECCCTTTCTTHHHHHHHHHHHHHTSTTTEEEEEECGGGHHHHHHHHTCCSS
T ss_pred HHHhcCCcccCHhHHHHHHhcCCCcEEEEEeCCccCCCchhhHHhHHHHHHHHccCCcEEEEEECCCCHHHHHHcCCccC
Confidence 34445667889999999887777799999999999 9999999999999999999999999999999999999999999
Q ss_pred cEEEEEeCCeEEEEEeCCCCHHHHHHHHHhhC
Q 029866 155 PTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL 186 (186)
Q Consensus 155 Pt~i~~~~G~~~~~~~G~~~~~~l~~~l~~~l 186 (186)
||+++|+||+++.+..|..++++|.++|++++
T Consensus 91 PTlilFkdG~~v~~~vG~~~k~~l~~~l~~~l 122 (137)
T 2qsi_A 91 PSLAVVQPERTLGVIAKIQDWSSYLAQIGAML 122 (137)
T ss_dssp SEEEEEECCEEEEEEESCCCHHHHHHHHHHHH
T ss_pred CEEEEEECCEEEEEEeCCCCHHHHHHHHHHHh
Confidence 99999999999999999999999999998753
|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A | Back alignment and structure |
|---|
| >3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A | Back alignment and structure |
|---|
| >3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A | Back alignment and structure |
|---|
| >1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A | Back alignment and structure |
|---|
| >1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A | Back alignment and structure |
|---|
| >1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A | Back alignment and structure |
|---|
| >2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A | Back alignment and structure |
|---|
| >1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D | Back alignment and structure |
|---|
| >2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A | Back alignment and structure |
|---|
| >3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A | Back alignment and structure |
|---|
| >2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A | Back alignment and structure |
|---|
| >3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A | Back alignment and structure |
|---|
| >3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} | Back alignment and structure |
|---|
| >3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} | Back alignment and structure |
|---|
| >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A | Back alignment and structure |
|---|
| >3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} | Back alignment and structure |
|---|
| >4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A | Back alignment and structure |
|---|
| >3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A | Back alignment and structure |
|---|
| >1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A | Back alignment and structure |
|---|
| >3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A | Back alignment and structure |
|---|
| >4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* | Back alignment and structure |
|---|
| >3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A | Back alignment and structure |
|---|
| >3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A | Back alignment and structure |
|---|
| >2in3_A Hypothetical protein; DSBA family, FRNE-like subfamily, disulfide isomerase, struc genomics, PSI-2, protein structure initiative; 1.85A {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3kzq_A Putative uncharacterized protein VP2116; protein with unknown function, STRU genomics, PSI, MCSG, protein structure initiative; HET: PG6; 2.10A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2imf_A HCCA isomerase, 2-hydroxychromene-2-carboxylate isomerase; glutathione, KGST, kappa GST, transferase; HET: GSH TOM CXS; 1.30A {Pseudomonas putida} PDB: 2ime_A* 2imd_A* | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1t4y_A Adaptive-response sensory-kinase SASA; alpha/beta protein, thioredoxin fold, transferase; NMR {Synechococcus elongatus} SCOP: c.47.1.15 PDB: 1t4z_A | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >3ktb_A Arsenical resistance operon trans-acting represso; alpha-beta-alpha sandwich, helix-turn-helix, structural GENO PSI-2; 2.10A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3gl5_A Putative DSBA oxidoreductase SCO1869; probable DSBA oxidoreductase structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.15A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3kgk_A Arsenical resistance operon trans-acting represso; alpha+beta, chaperone, DNA-binding, RE transcription, transcription regulation; 1.40A {Escherichia coli} PDB: 3mwh_A | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >1r4w_A Glutathione S-transferase, mitochondrial; glutathione transferase, kappa GST, RGSTK1-1; HET: GSH; 2.50A {Rattus norvegicus} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >3fz5_A Possible 2-hydroxychromene-2-carboxylate isomeras; 2-hydroxychromene-2-carboxylate ISO structural genomics, PSI-2; HET: MSE GSH PGE; 2.40A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >2g2q_A Glutaredoxin-2; thioredoxin-fold, oxidoreductase, poxvirus; 2.50A {Vaccinia virus} | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3rpp_A Glutathione S-transferase kappa 1; glutathione transferase, kappa GST, TRX domain, GSH binding, detoxification, APO form; 1.80A {Homo sapiens} PDB: 3rpn_A 1yzx_A* | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >4g9p_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; oxidoreductase, isoprenoid biosynthesis, non mevalonate PATH iron-sulphur-cluster; HET: CDI MES; 1.55A {Thermus thermophilus} PDB: 2y0f_A* | Back alignment and structure |
|---|
| >1wwj_A Circadian clock protein KAIB; 1.90A {Synechocystis SP} PDB: 1r5p_A 2qke_A 1vgl_A | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 186 | ||||
| d2trxa_ | 108 | c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId | 5e-33 | |
| d1dbya_ | 107 | c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt | 4e-31 | |
| d1nw2a_ | 105 | c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidoc | 1e-28 | |
| d1thxa_ | 108 | c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 | 2e-28 | |
| d1fb6a_ | 104 | c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera | 2e-28 | |
| d2es7a1 | 119 | c.47.1.20 (A:7-125) Hydrogenase-1 operon protein H | 3e-28 | |
| d2hfda1 | 132 | c.47.1.20 (A:1-132) Hydrogenase-1 operon protein H | 1e-25 | |
| d1gh2a_ | 107 | c.47.1.1 (A:) Thioredoxin-like protein, N-terminal | 4e-24 | |
| d1f9ma_ | 112 | c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera | 1e-23 | |
| d2b5ea1 | 140 | c.47.1.2 (A:365-504) Protein disulfide isomerase, | 2e-23 | |
| d2ifqa1 | 105 | c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapien | 3e-23 | |
| d1qgva_ | 137 | c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human | 3e-23 | |
| d2djja1 | 116 | c.47.1.2 (A:6-121) Protein disulfide isomerase, PD | 1e-22 | |
| d1nhoa_ | 85 | c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-lik | 5e-22 | |
| d2trcp_ | 217 | c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [ | 7e-22 | |
| d1meka_ | 120 | c.47.1.2 (A:) Protein disulfide isomerase, PDI {Hu | 3e-21 | |
| d1syra_ | 103 | c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plas | 6e-20 | |
| d1ep7a_ | 112 | c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt | 8e-20 | |
| d1xfla_ | 114 | c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsi | 3e-19 | |
| d1a8la2 | 107 | c.47.1.2 (A:120-226) Protein disulfide isomerase, | 4e-18 | |
| d2b5xa1 | 143 | c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase | 8e-18 | |
| d1xwaa_ | 111 | c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila m | 9e-18 | |
| d1ti3a_ | 113 | c.47.1.1 (A:) Thioredoxin {European aspen (Populus | 1e-17 | |
| d2c0ga2 | 122 | c.47.1.7 (A:1024-1145) Windbeutel, N-terminal doma | 4e-17 | |
| d1r26a_ | 113 | c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [Tax | 5e-17 | |
| d1zmaa1 | 115 | c.47.1.1 (A:1-115) Bacterocin transport accessory | 7e-17 | |
| d1fo5a_ | 85 | c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-lik | 7e-17 | |
| d1g7ea_ | 122 | c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, | 1e-16 | |
| d1woua_ | 119 | c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxi | 1e-16 | |
| d2fy6a1 | 143 | c.47.1.10 (A:33-175) Peptide methionine sulfoxide | 3e-16 | |
| d1wjka_ | 100 | c.47.1.1 (A:) Thioredoxin-like structure containin | 6e-15 | |
| d1z5ye1 | 136 | c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG | 1e-14 | |
| d2b5ea4 | 119 | c.47.1.2 (A:23-141) Protein disulfide isomerase, P | 4e-14 | |
| d1a8ya1 | 124 | c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctola | 9e-14 | |
| d1z6na1 | 166 | c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Ps | 5e-13 | |
| d1sena_ | 135 | c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 | 4e-12 | |
| d1hyua4 | 96 | c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase | 7e-12 | |
| d2fwha1 | 117 | c.47.1.1 (A:428-544) Thiol:disulfide interchange p | 2e-11 | |
| d1i5ga_ | 144 | c.47.1.10 (A:) Tryparedoxin II {Crithidia fascicul | 2e-10 | |
| d1lu4a_ | 134 | c.47.1.10 (A:) Soluble secreted antigen MPT53 {Myc | 6e-10 | |
| d1knga_ | 144 | c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY | 1e-09 | |
| d1o73a_ | 144 | c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei | 2e-07 | |
| d2dlxa1 | 147 | c.47.1.24 (A:1-147) UBX domain-containing protein | 2e-06 | |
| d1zzoa1 | 134 | c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacteri | 3e-06 | |
| d1z6ma1 | 172 | c.47.1.13 (A:1-172) Hypothetical protein EF0770 {E | 0.003 |
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Length = 108 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Thioltransferase domain: Thioredoxin species: Escherichia coli [TaxId: 562]
Score = 112 bits (280), Expect = 5e-33
Identities = 47/101 (46%), Positives = 70/101 (69%)
Query: 86 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSI 145
+TD ++ + VL + +LV+FWA WCGPC+MI PI+DE++ +Y GKL K+N D++P
Sbjct: 7 LTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGT 66
Query: 146 ATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL 186
A +YGIR IPT+++FKNGE T +GA+ K L ++ L
Sbjct: 67 APKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL 107
|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 107 | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Length = 105 | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Length = 108 | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Length = 104 | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Length = 119 | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Length = 132 | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Length = 112 | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 116 | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 85 | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 217 | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 103 | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 112 | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 114 | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 107 | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Length = 143 | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 111 | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Length = 113 | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Length = 113 | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 85 | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Length = 143 | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Length = 136 | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 119 | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 124 | Back information, alignment and structure |
|---|
| >d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 96 | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Length = 117 | Back information, alignment and structure |
|---|
| >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Length = 144 | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 134 | Back information, alignment and structure |
|---|
| >d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Length = 144 | Back information, alignment and structure |
|---|
| >d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Length = 144 | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Length = 134 | Back information, alignment and structure |
|---|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Length = 172 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 186 | |||
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.96 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.96 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 99.96 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 99.96 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 99.95 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 99.94 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.94 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 99.93 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 99.93 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 99.93 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.93 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 99.92 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 99.92 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 99.92 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 99.92 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 99.91 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 99.9 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 99.9 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.9 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 99.9 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 99.88 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 99.87 | |
| d2b5ea1 | 140 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.86 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 99.86 | |
| d2djja1 | 116 | Protein disulfide isomerase, PDI {Fungi (Humicola | 99.85 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 99.84 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 99.84 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 99.81 | |
| d2c0ga2 | 122 | Windbeutel, N-terminal domain {Fruit fly (Drosophi | 99.8 | |
| d1z5ye1 | 136 | Thioredoxin-like protein CcmG (CycY, DsbE) {Escher | 99.79 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 99.79 | |
| d1zzoa1 | 134 | Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI | 99.75 | |
| d2fy6a1 | 143 | Peptide methionine sulfoxide reductase MsrA/MsrB, | 99.74 | |
| d1g7ea_ | 122 | Endoplasmic reticulum protein ERP29, N-terminal do | 99.73 | |
| d2b5xa1 | 143 | thiol:disulfide oxidoreductase YkuV {Bacillus subt | 99.73 | |
| d1lu4a_ | 134 | Soluble secreted antigen MPT53 {Mycobacterium tube | 99.73 | |
| d2trcp_ | 217 | Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.71 | |
| d1knga_ | 144 | Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr | 99.7 | |
| d1st9a_ | 137 | Thiol-disulfide oxidoreductase ResA {Bacillus subt | 99.69 | |
| d2cvba1 | 187 | Probable thiol-disulfide isomerase/thioredoxin TTH | 99.67 | |
| d1i5ga_ | 144 | Tryparedoxin II {Crithidia fasciculata [TaxId: 565 | 99.63 | |
| d1o73a_ | 144 | Tryparedoxin I {Trypanosoma brucei brucei [TaxId: | 99.6 | |
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 99.57 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 99.55 | |
| d1jfua_ | 176 | Membrane-anchored thioredoxin-like protein TlpA, s | 99.53 | |
| d1o8xa_ | 144 | Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 | 99.52 | |
| d1sena_ | 135 | Thioredoxin-like protein p19, TLP19 {Human (Homo s | 99.48 | |
| d1z6na1 | 166 | Hypothetical protein PA1234 {Pseudomonas aeruginos | 99.37 | |
| d2a4va1 | 156 | Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c | 99.23 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 99.15 | |
| d2cx4a1 | 160 | Bacterioferritin comigratory protein {Archaeon Aer | 99.15 | |
| d2f8aa1 | 184 | Glutathione peroxidase {Human (Homo sapiens) [TaxI | 99.11 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 99.09 | |
| d1e2ya_ | 167 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 99.08 | |
| d2bmxa1 | 169 | Alkyl hydroperoxide reductase AhpC {Mycobacterium | 99.03 | |
| d1we0a1 | 166 | Alkyl hydroperoxide reductase AhpC {Amphibacillus | 98.99 | |
| d1xvwa1 | 153 | Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri | 98.96 | |
| d1v58a1 | 169 | Thiol:disulfide interchange protein DsbG, C-termin | 98.94 | |
| d1zofa1 | 170 | Thioredoxin reductase TsaA {Helicobacter pylori [T | 98.9 | |
| d1qxha_ | 164 | Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 | 98.9 | |
| d1zyea1 | 158 | Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ | 98.88 | |
| d1beda_ | 181 | Disulfide-bond formation facilitator (DsbA) {Vibri | 98.87 | |
| d1psqa_ | 163 | Probable thiol peroxidase PsaD {Streptococcus pneu | 98.82 | |
| d1xzoa1 | 172 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 98.8 | |
| d1uula_ | 194 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 98.8 | |
| d2zcta1 | 237 | Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | 98.77 | |
| d1z6ma1 | 172 | Hypothetical protein EF0770 {Enterococcus faecalis | 98.77 | |
| d1wp0a1 | 160 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 98.72 | |
| d1q98a_ | 164 | Thiol peroxidase Tpx {Haemophilus influenzae [TaxI | 98.6 | |
| d1xvqa_ | 166 | Thiol peroxidase Tpx {Mycobacterium tuberculosis [ | 98.58 | |
| d1n8ja_ | 186 | Alkyl hydroperoxide reductase AhpC {Salmonella typ | 98.54 | |
| d1a8la1 | 119 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 98.54 | |
| d2h01a1 | 170 | Thioredoxin peroxidase 2 (thioredoxin peroxidase B | 98.5 | |
| d1qmva_ | 197 | Thioredoxin peroxidase 2 (thioredoxin peroxidase B | 98.5 | |
| d2djka1 | 133 | Protein disulfide isomerase, PDI {Fungi (Humicola | 98.47 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 98.41 | |
| d1fvka_ | 188 | Disulfide-bond formation facilitator (DsbA) {Esche | 98.39 | |
| d1prxa_ | 220 | 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: | 98.36 | |
| d2b5ea3 | 125 | Protein disulfide isomerase, PDI {Baker's yeast (S | 98.35 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 98.35 | |
| d2b7ka1 | 169 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 98.3 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 98.26 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 98.22 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 98.07 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 98.01 | |
| d1xcca_ | 219 | 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax | 97.97 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 97.81 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 97.79 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 97.02 | |
| d1hd2a_ | 161 | Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 | 96.95 | |
| d1a8ya2 | 102 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 96.78 | |
| d1bjxa_ | 110 | Protein disulfide isomerase, PDI {Human (Homo sapi | 96.36 | |
| d1hyua3 | 102 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 96.33 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 96.19 | |
| d1un2a_ | 195 | Disulfide-bond formation facilitator (DsbA) {Esche | 96.06 | |
| d2axoa1 | 225 | Hypothetical protein Atu2684 {Agrobacterium tumefa | 95.82 | |
| d1t4za_ | 105 | Adaptive-response sensory-kinase SasA, N-terminal | 95.25 | |
| d1tp9a1 | 162 | Plant peroxiredoxin {Western balsam poplar(Populus | 95.06 | |
| d1nm3a2 | 163 | N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus | 94.61 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 94.5 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 91.92 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 90.1 | |
| d1r4wa_ | 221 | Mitochondrial class kappa glutathione S-transferas | 89.86 | |
| d1un2a_ | 195 | Disulfide-bond formation facilitator (DsbA) {Esche | 89.42 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 88.04 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 87.94 | |
| d1r5pa_ | 90 | Circadian oscillation regulator KaiB {Cyanobacteri | 86.85 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 86.78 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 84.68 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 82.42 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 80.78 |
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Thioltransferase domain: Thioredoxin species: Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]
Probab=99.96 E-value=1.9e-29 Score=173.73 Aligned_cols=104 Identities=65% Similarity=1.251 Sum_probs=100.0
Q ss_pred ccccChhHHHHHHHhCCCcEEEEEECCCCcccccchHHHHHHHHHhcCceEEEEEeCCCChHHHHHcCCCcccEEEEEeC
Q 029866 83 VPAVTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKN 162 (186)
Q Consensus 83 v~~l~~~~~~~~~~~~~k~vvv~F~a~wC~~C~~~~p~l~~l~~~~~~~v~~~~v~~d~~~~l~~~~~i~~~Pt~i~~~~ 162 (186)
+.++|+++|++.+..++++++|+||++||++|+++.|.+.++++++.+++.++.+|+|++++++++|+|+++||+++|++
T Consensus 1 v~el~d~~f~~~v~~~~~~vlv~F~a~wC~~C~~~~~~~~~l~~~~~~~~~~~~v~~d~~~~l~~~~~V~~~Pt~~~~~~ 80 (104)
T d1fb6a_ 1 VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKN 80 (104)
T ss_dssp CEECCTTTHHHHTTTCSSCEEEEEECTTCHHHHHHHHHHHHHHHHTTTTCEEEEEETTTCHHHHHHTTCCSSSEEEEEET
T ss_pred CeECchhhHHHHHHcCCCcEEEEEEcCccCCccccCchhHHHHHhhcCccceeEEecccchhhhhhcceeeeeEEEEEEc
Confidence 46789999999888889999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CeEEEEEeCCCCHHHHHHHHHhhC
Q 029866 163 GEKKDTVIGAVPKSTLTTSIEKFL 186 (186)
Q Consensus 163 G~~~~~~~G~~~~~~l~~~l~~~l 186 (186)
|+++.++.|..+.++|.++|+++|
T Consensus 81 G~~v~~~~G~~~~~~l~~~i~~~L 104 (104)
T d1fb6a_ 81 GERKESIIGAVPKSTLTDSIEKYL 104 (104)
T ss_dssp TEEEEEEEECCCHHHHHHHHHHHC
T ss_pred CeEEEEEeCCCCHHHHHHHHHHhC
Confidence 999999999999999999999986
|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} | Back information, alignment and structure |
|---|
| >d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyua3 c.47.1.2 (A:1-102) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1t4za_ c.47.1.15 (A:) Adaptive-response sensory-kinase SasA, N-terminal domain {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} | Back information, alignment and structure |
|---|
| >d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r4wa_ c.47.1.13 (A:) Mitochondrial class kappa glutathione S-transferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r5pa_ c.47.1.15 (A:) Circadian oscillation regulator KaiB {Cyanobacterium (Nostoc sp.) pcc 7120 [TaxId: 1180]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|