Citrus Sinensis ID: 029878


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MLSMSFHCHINAVLTPDTSSATAKWPSQNLPLKPFTKTSVMLRPQISYLKLRHGTRQVRVKHSSSSAAIDQTLDPEPPADDSDCDIILRKEKLGVVVKPNEKRRLVLKFIWMQNDIGIALDQVIPGHGTIPLSPYYFWPRKDAWEELKVLLDSKPWISQTERIHLLNQATDVINFWQTSGGNLQQG
cccccccccccccccccccccccccccccccccccccccccccccccCEECccccccccccccccHHccccccccccccccccccHHHHHHccccEEccccccEEEEEEEEEcccEEEEEEEECccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccc
*****FHCHINAVLTPDT***************PFTKTSVMLRP*********************************************KEKLGVVVKPNEKRRLVLKFIWMQNDIGIALDQVIPGHGTIPLSPYYFWPRKDAWEELKVLLDSKPWISQTERIHLLNQATDVINFWQT********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSMSFHCHINAVLTPDTSSATAKWPSQNLPLKPFTKTSVMLRPQISYLKLRHGTRQVRVKHSSSSAAIDQTLDPEPPADDSDCDIILRKEKLGVVVKPNEKRRLVLKFIWMQNDIGIALDQVIPGHGTIPLSPYYFWPRKDAWEELKVLLDSKPWISQTERIHLLNQATDVINFWQTSGGNLQQG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
30S ribosomal protein 3-2, chloroplastic Probably a ribosomal protein or a ribosome-associated protein.probableQ9LFV0
30S ribosomal protein 3, chloroplastic One of the plastid-specific ribosomal proteins.probableP82412

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KT9, chain A
Confidence level:very confident
Coverage over the Query: 101-178
View the alignment between query and template
View the model in PyMOL