Citrus Sinensis ID: 029983


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMSPRWYIRNFDYHEARMIHLSYHDGEHYNGVRLKEDSCIGSARPIIIKADADISAASIQSKTVTSKLKGAAGIINAGSIKLVMAGSGCENSEKVEEVLLQVGGDVDAAIEFLIAEQGTEEYSVKKQ
cHHHHHHHcHHcccccccccccHHHHHHHHccccccccHHHHHHHHHHccccEEEEEcccccEEEcccccccccEEEEEEccccccccccccccccccccccEEEcccHHHHHHHHHcccHHccccccccccccHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHccccccccccc
cHHHHHHHcHHHccHHccccccHHHHHHHHccccccccHHHHHHHHHHccccEEEEEccccEEEEEccccccccEEEEEEEcccccccEEEcccccccccccEEEEccccccHcHHcccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccHccc
MVVQYIVKNRetfepfieddvpfdeycqsmetdgtwagHMELQAASLVTHsnicihrhmsprwyirnfDYHEARMIHLsyhdgehyngvrlkedscigsarpiiikadadisaasiqSKTVTSKLKGAAGIINAGSIKLVMagsgcensEKVEEVLLQVGGDVDAAIEFLIAeqgteeysvkkq
MVVQYIVknretfepfieddvPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMSPRWYIRNFDYHEARMIHLSYHDGEHYNGVRLKEDSCIGSARPIIIKADADISAASIQSKtvtsklkgaagiINAGSIKLVMAGSGCENSEKVEEVLLQVGGDVDAAIEFLiaeqgteeysvkkq
MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMSPRWYIRNFDYHEARMIHLSYHDGEHYNGVRLKEDSCIGSARPiiikadadisaasiQSKTVTSKLKGAAGIINAGSIKLVMAGSGCENSEKVEEVLLQVGGDVDAAIEFLIAEQGTEEYSVKKQ
**VQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMSPRWYIRNFDYHEARMIHLSYHDGEHYNGVRLKEDSCIGSARPIIIKADADISAASIQSKTVTSKLKGAAGIINAGSIKLVMAGSGCENSEKVEEVLLQVGGDVDAAIEFLIAE***********
MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMSPRWYIRNFDYHEARMIHLSYHDGEHYNGVRLKEDS**G**************************************IKLVMAGSGCENSEKVEEVLLQVGGDVDAAIEF***************
MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMSPRWYIRNFDYHEARMIHLSYHDGEHYNGVRLKEDSCIGSARPIIIKADADISAASIQSKTVTSKLKGAAGIINAGSIKLVMAGSGCENSEKVEEVLLQVGGDVDAAIEFLIAEQG*********
MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMSPRWYIRNFDYHEARMIHLSYHDGEHYNGVRLKEDSCIGSARPIIIKADA**********************INAGSIKLVMAGSGCENSEKVEEVLLQVGGDVDAAIEFLIAEQG*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMSPRWYIRNFDYHEARMIHLSYHDGEHYNGVRLKEDSCIGSARPIIIKADADISAASIQSKTVTSKLKGAAGIINAGSIKLVMAGSGCENSEKVEEVLLQVGGDVDAAIEFLIAEQGTEEYSVKKQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
Q5T2D3 398 OTU domain-containing pro yes no 0.668 0.309 0.349 4e-16
Q01804 1113 OTU domain-containing pro no no 0.489 0.080 0.32 3e-06
B2RRE7 1107 OTU domain-containing pro no no 0.445 0.074 0.325 2e-05
>sp|Q5T2D3|OTUD3_HUMAN OTU domain-containing protein 3 OS=Homo sapiens GN=OTUD3 PE=1 SV=1 Back     alignment and function desciption
 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 69/126 (54%), Gaps = 3/126 (2%)

Query: 2   VVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMSP 61
            V Y++K RE FEPF+EDD+PF+++  S+   GT+AG+  + A +     N+ IH+  +P
Sbjct: 99  TVDYMIKQREDFEPFVEDDIPFEKHVASLAKPGTFAGNDAIVAFARNHQLNVVIHQLNAP 158

Query: 62  RWYIRNFDYHEARMIHLSYHDGEHYNGVRLKEDSCIGSARPIIIKADADISAASIQSKTV 121
            W IR  +    R +H++Y  GEHY+ VR   D+   S  P  ++ D  +      +K  
Sbjct: 159 LWQIRGTEKSSVRELHIAYRYGEHYDSVRRINDN---SEAPAHLQTDFQMLHQDESNKRE 215

Query: 122 TSKLKG 127
             K KG
Sbjct: 216 KIKTKG 221





Homo sapiens (taxid: 9606)
>sp|Q01804|OTUD4_HUMAN OTU domain-containing protein 4 OS=Homo sapiens GN=OTUD4 PE=1 SV=3 Back     alignment and function description
>sp|B2RRE7|OTUD4_MOUSE OTU domain-containing protein 4 OS=Mus musculus GN=Otud4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
296082384 385 unnamed protein product [Vitis vinifera] 0.967 0.462 0.772 7e-78
225438775 467 PREDICTED: OTU domain-containing protein 0.967 0.381 0.772 1e-77
356565555 382 PREDICTED: OTU domain-containing protein 0.983 0.473 0.754 2e-77
224081718 349 predicted protein [Populus trichocarpa] 0.983 0.518 0.741 2e-76
255565284 371 OTU domain-containing protein, putative 0.978 0.485 0.736 7e-76
23306370 375 putative protein [Arabidopsis thaliana] 0.978 0.48 0.703 3e-73
30698282 375 SEC-C motif-containing protein / OTU-lik 0.978 0.48 0.703 5e-73
42573818 374 SEC-C motif-containing protein / OTU-lik 0.978 0.481 0.703 5e-73
10177604 382 unnamed protein product [Arabidopsis tha 0.978 0.471 0.703 7e-73
297797661 374 hypothetical protein ARALYDRAFT_496882 [ 0.961 0.473 0.720 2e-72
>gi|296082384|emb|CBI21389.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  295 bits (754), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 156/180 (86%), Gaps = 2/180 (1%)

Query: 1   MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMS 60
           MVV+YI++NR+ FEPFIEDDVPFD+YCQSME DGTWAGHMELQAASLVT SNICIHRHMS
Sbjct: 72  MVVRYILENRDMFEPFIEDDVPFDDYCQSMEKDGTWAGHMELQAASLVTRSNICIHRHMS 131

Query: 61  PRWYIRNFDYHEARMIHLSYHDGEHYNGVRLKEDSCIGSARPIIIKADADISAASIQSKT 120
           PRWYI+NF+   ARMIHLSYHDGEHYN VRLKED C G ARPIIIKAD D+S AS Q K 
Sbjct: 132 PRWYIQNFNASGARMIHLSYHDGEHYNSVRLKEDPCDGPARPIIIKADTDLSVASHQVKG 191

Query: 121 VTSKLKGAAG--IINAGSIKLVMAGSGCENSEKVEEVLLQVGGDVDAAIEFLIAEQGTEE 178
            +SK K  AG  II+AGSIKLVM GSGCEN+EKVE+VL+++ GDVDAAIE+LIAE+ TEE
Sbjct: 192 ASSKSKSGAGRNIIDAGSIKLVMVGSGCENAEKVEQVLVELSGDVDAAIEYLIAERETEE 251




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225438775|ref|XP_002278347.1| PREDICTED: OTU domain-containing protein 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356565555|ref|XP_003551005.1| PREDICTED: OTU domain-containing protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|224081718|ref|XP_002306480.1| predicted protein [Populus trichocarpa] gi|222855929|gb|EEE93476.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255565284|ref|XP_002523634.1| OTU domain-containing protein, putative [Ricinus communis] gi|223537196|gb|EEF38829.1| OTU domain-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|23306370|gb|AAN17412.1| putative protein [Arabidopsis thaliana] gi|25084238|gb|AAN72203.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30698282|ref|NP_201518.2| SEC-C motif-containing protein / OTU-like cysteine protease family protein [Arabidopsis thaliana] gi|332010926|gb|AED98309.1| SEC-C motif-containing protein / OTU-like cysteine protease family protein [Arabidopsis thaliana] gi|407078848|gb|AFS88955.1| OTU-containing deubiquitinating enzyme OTU7 isoform i [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42573818|ref|NP_975005.1| SEC-C motif-containing protein / OTU-like cysteine protease family protein [Arabidopsis thaliana] gi|332010927|gb|AED98310.1| SEC-C motif-containing protein / OTU-like cysteine protease family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|10177604|dbj|BAB10951.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297797661|ref|XP_002866715.1| hypothetical protein ARALYDRAFT_496882 [Arabidopsis lyrata subsp. lyrata] gi|297312550|gb|EFH42974.1| hypothetical protein ARALYDRAFT_496882 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
TAIR|locus:2155588 375 AT5G67170 [Arabidopsis thalian 0.961 0.472 0.670 2.1e-61
DICTYBASE|DDB_G0267906 438 DDB_G0267906 "OTU domain conta 0.483 0.203 0.510 4.6e-24
ZFIN|ZDB-GENE-040426-2509357 otud3 "OTU domain containing 3 0.505 0.260 0.344 9.8e-13
GENEDB_PFALCIPARUM|PF10_0308 938 PF10_0308 "OTU-like cysteine p 0.489 0.095 0.362 1.4e-10
UNIPROTKB|Q8IJ91 938 PF10_0308 "OTU-like cysteine p 0.489 0.095 0.362 1.4e-10
UNIPROTKB|Q01804 1113 OTUD4 "OTU domain-containing p 0.489 0.080 0.32 7.2e-07
MGI|MGI:1098801 1107 Otud4 "OTU domain containing 4 0.434 0.072 0.321 2.8e-05
DICTYBASE|DDB_G0279375340 DDB_G0279375 "OTU domain conta 0.434 0.235 0.385 0.00014
ASPGD|ASPL0000061651 472 AN0173 [Emericella nidulans (t 0.755 0.294 0.259 0.00023
UNIPROTKB|G4NEZ8304 MGG_11505 "Uncharacterized pro 0.456 0.276 0.319 0.00038
TAIR|locus:2155588 AT5G67170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 628 (226.1 bits), Expect = 2.1e-61, P = 2.1e-61
 Identities = 120/179 (67%), Positives = 139/179 (77%)

Query:     1 MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMS 60
             M+V YIVKNRE FEPFIEDDVPF++YC++M+ DGTWAG+MELQAASLVT SNICIHR+MS
Sbjct:    70 MIVLYIVKNREMFEPFIEDDVPFEDYCKTMDDDGTWAGNMELQAASLVTRSNICIHRNMS 129

Query:    61 PRWYIRNFDYHEARMIHLSYHDGEHYNGVRLKEDSCIGSARPXXXXXXXXXXXXXXQSKT 120
             PRWYIRNF+    RMIHLSYHDGEHYN VR KED+C G ARP              Q+K 
Sbjct:   130 PRWYIRNFEDTRTRMIHLSYHDGEHYNSVRSKEDACGGPARPVVIEADAKVSAASKQAKA 189

Query:   121 VTSKLKGAAGI--INAGSIKLVMAGSGCENSEKVEEVLLQVGGDVDAAIEFLIAEQGTE 177
               SK K  A    +NAG+IK+VM+GS C+N+EK E+VLLQV GDVDAAIEFLIA+QG E
Sbjct:   190 TESKSKNKADKCHVNAGAIKVVMSGSCCDNTEKAEQVLLQVNGDVDAAIEFLIADQGME 248




GO:0005634 "nucleus" evidence=ISM
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008234 "cysteine-type peptidase activity" evidence=ISS
DICTYBASE|DDB_G0267906 DDB_G0267906 "OTU domain containin protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2509 otud3 "OTU domain containing 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF10_0308 PF10_0308 "OTU-like cysteine protease, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IJ91 PF10_0308 "OTU-like cysteine protease, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|Q01804 OTUD4 "OTU domain-containing protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1098801 Otud4 "OTU domain containing 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279375 DDB_G0279375 "OTU domain containin protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000061651 AN0173 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4NEZ8 MGG_11505 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_V000542
hypothetical protein (349 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
pfam02338123 pfam02338, OTU, OTU-like cysteine protease 7e-14
pfam10275237 pfam10275, Peptidase_C65, Peptidase C65 Otubain 6e-05
>gnl|CDD|216981 pfam02338, OTU, OTU-like cysteine protease Back     alignment and domain information
 Score = 64.5 bits (157), Expect = 7e-14
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 12/96 (12%)

Query: 1   MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMS 60
            VV+Y+ +NRE FE F+E+D   +EY + +  DG W G++E+ A + +    I +++   
Sbjct: 30  AVVEYLRENREDFEKFLEED--ENEYYKWISKDGAWGGNIEIFALAHILRVPIIVYKLQG 87

Query: 61  PR--WYIRNFDYHE----ARMIHLSYH----DGEHY 86
            R   YI+ +  +       +I LSY      G HY
Sbjct: 88  GRITVYIKIYGTYLPLNKKPVIRLSYLGLEYTGNHY 123


This family is comprised of a group of predicted cysteine proteases, homologous to the Ovarian Tumour (OTU) gene in Drosophila. Members include proteins from eukaryotes, viruses and pathogenic bacterium. The conserved cysteine and histidine, and possibly the aspartate, represent the catalytic residues in this putative group of proteases. Length = 123

>gnl|CDD|220671 pfam10275, Peptidase_C65, Peptidase C65 Otubain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
KOG2606302 consensus OTU (ovarian tumor)-like cysteine protea 99.85
KOG3288307 consensus OTU-like cysteine protease [Signal trans 99.51
PF02338121 OTU: OTU-like cysteine protease; InterPro: IPR0033 99.5
KOG3991256 consensus Uncharacterized conserved protein [Funct 99.36
PF10275244 Peptidase_C65: Peptidase C65 Otubain; InterPro: IP 99.34
KOG2605371 consensus OTU (ovarian tumor)-like cysteine protea 98.45
COG5539306 Predicted cysteine protease (OTU family) [Posttran 98.42
COG5539306 Predicted cysteine protease (OTU family) [Posttran 98.24
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 97.55
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 97.42
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 97.29
smart0054643 CUE Domain that may be involved in binding ubiquit 97.01
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 96.97
TIGR00264116 alpha-NAC-related protein. This hypothetical prote 96.94
PRK06369115 nac nascent polypeptide-associated complex protein 96.88
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 96.42
COG1308122 EGD2 Transcription factor homologous to NACalpha-B 95.31
PF0697260 DUF1296: Protein of unknown function (DUF1296); In 95.17
PF0347439 DMA: DMRTA motif; InterPro: IPR005173 This region 93.94
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 88.8
PF0893879 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This 84.08
PF0295442 HTH_8: Bacterial regulatory protein, Fis family; I 81.56
>KOG2606 consensus OTU (ovarian tumor)-like cysteine protease [Signal transduction mechanisms; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.85  E-value=5.3e-22  Score=169.30  Aligned_cols=91  Identities=31%  Similarity=0.582  Sum_probs=79.8

Q ss_pred             ChHHHHHhCccccccccCCC--------CCHHHHHHhhhcCCccCCHHHHHHHHhhcCccEEEEEccCCceEEee-cccC
Q 029983            1 MVVQYIVKNRETFEPFIEDD--------VPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMSPRWYIRN-FDYH   71 (184)
Q Consensus         1 lvv~yi~~n~d~F~pFv~~~--------~~f~~Y~~~m~k~g~WGg~iEL~Ala~~~~v~I~V~~~~~~~~~i~~-~~~~   71 (184)
                      ++|+||++|.++|.||+.++        .+|+.||+.|+.++.|||++||.|||.+|++||.||+.++|...++. |.  
T Consensus       195 ~~a~Ymr~H~~df~pf~~~eet~d~~~~~~f~~Yc~eI~~t~~WGgelEL~AlShvL~~PI~Vy~~~~p~~~~geey~--  272 (302)
T KOG2606|consen  195 ETADYMREHVEDFLPFLLDEETGDSLGPEDFDKYCREIRNTAAWGGELELKALSHVLQVPIEVYQADGPILEYGEEYG--  272 (302)
T ss_pred             HHHHHHHHHHHHhhhHhcCccccccCCHHHHHHHHHHhhhhccccchHHHHHHHHhhccCeEEeecCCCceeechhhC--
Confidence            47999999999999999864        25999999999999999999999999999999999999998776653 32  


Q ss_pred             CCcEEEEEEc-----cCCcccceeccC
Q 029983           72 EARMIHLSYH-----DGEHYNGVRLKE   93 (184)
Q Consensus        72 ~~~~i~L~Y~-----~g~HYdSV~~~~   93 (184)
                      +.++|.|+||     .|+||||+.+..
T Consensus       273 kd~pL~lvY~rH~y~LGeHYNS~~~~~  299 (302)
T KOG2606|consen  273 KDKPLILVYHRHAYGLGEHYNSVTPLK  299 (302)
T ss_pred             CCCCeeeehHHhHHHHHhhhccccccc
Confidence            2579999998     499999998754



>KOG3288 consensus OTU-like cysteine protease [Signal transduction mechanisms; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02338 OTU: OTU-like cysteine protease; InterPro: IPR003323 This is a group of proteins found primarily in viruses, eukaryotes and in the pathogenic bacterium Chlamydia pneumoniae Back     alignment and domain information
>KOG3991 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10275 Peptidase_C65: Peptidase C65 Otubain; InterPro: IPR019400 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2605 consensus OTU (ovarian tumor)-like cysteine protease [Signal transduction mechanisms; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5539 Predicted cysteine protease (OTU family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5539 Predicted cysteine protease (OTU family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>TIGR00264 alpha-NAC-related protein Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription] Back     alignment and domain information
>PF06972 DUF1296: Protein of unknown function (DUF1296); InterPro: IPR009719 This family represents a conserved region approximately 60 residues long within a number of plant proteins of unknown function Back     alignment and domain information
>PF03474 DMA: DMRTA motif; InterPro: IPR005173 This region is found to the C terminus of the DM DNA-binding domain IPR001275 from INTERPRO [] Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>PF08938 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This domain is found in various eukaryotic HBS1-like proteins Back     alignment and domain information
>PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
3pfy_A185 OTU domain-containing protein 5; structural genomi 4e-24
3phx_A185 RNA-directed RNA polymerase L; OTU domain, DE-ubiq 3e-22
3phu_A219 RNA-directed RNA polymerase L; OTU domain, DE-ubiq 4e-21
3by4_A212 OTU1, ubiquitin thioesterase OTU1; ubiquitin hydro 3e-19
2zfy_A234 Ubiquitin thioesterase OTUB1; otubain, structural 4e-13
1tff_A234 Ubiquitin thiolesterase protein OTUB2; hydrolase; 4e-10
4dhi_B284 Ubiquitin thioesterase otubain-like; ubiquitin E2 4e-08
>3pfy_A OTU domain-containing protein 5; structural genomics, structural genomics consortium, SGC, PE C65 otubain, hydrolase; HET: MSE PG4; 1.70A {Homo sapiens} PDB: 3tmp_A* 3tmo_A* Length = 185 Back     alignment and structure
 Score = 92.5 bits (229), Expect = 4e-24
 Identities = 20/96 (20%), Positives = 42/96 (43%), Gaps = 3/96 (3%)

Query: 1   MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMS 60
             + Y++KN + F  ++ +D  F  Y      +     H+E+QA + + +  + ++++ +
Sbjct: 92  HCMDYLMKNADYFSNYVTED--FTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYST 149

Query: 61  PRW-YIRNFDYHEARMIHLSYHDGEHYNGVRLKEDS 95
                      +E   I +SYH   HYN V     +
Sbjct: 150 EPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKA 185


>3phx_A RNA-directed RNA polymerase L; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Crimean-congo hemorrhagic fever virus} PDB: 3phw_A 3pt2_A 3pse_A 3prp_A 3prm_A Length = 185 Back     alignment and structure
>3phu_A RNA-directed RNA polymerase L; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase; 2.20A {Crimean-congo hemorrhagic fever VIRUSIBAR10200} Length = 219 Back     alignment and structure
>3by4_A OTU1, ubiquitin thioesterase OTU1; ubiquitin hydrolase, deubiquitinase, cell cycle, hydrolase; 1.55A {Saccharomyces cerevisiae} PDB: 3c0r_A Length = 212 Back     alignment and structure
>2zfy_A Ubiquitin thioesterase OTUB1; otubain, structural genomics, structural genomics consortium, SGC, alternative splicing, hydrolase, immune response; 1.69A {Homo sapiens} PDB: 4ddg_B 4ddi_A Length = 234 Back     alignment and structure
>1tff_A Ubiquitin thiolesterase protein OTUB2; hydrolase; 2.10A {Homo sapiens} SCOP: d.3.1.11 Length = 234 Back     alignment and structure
>4dhi_B Ubiquitin thioesterase otubain-like; ubiquitin E2 enzyme fold, ubiquitination, hydrolase-ligase C; 1.80A {Caenorhabditis elegans} PDB: 4dhj_A 4dhz_A Length = 284 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
3pfy_A185 OTU domain-containing protein 5; structural genomi 99.93
3by4_A212 OTU1, ubiquitin thioesterase OTU1; ubiquitin hydro 99.91
3phu_A219 RNA-directed RNA polymerase L; OTU domain, DE-ubiq 99.9
3phx_A185 RNA-directed RNA polymerase L; OTU domain, DE-ubiq 99.9
1tff_A234 Ubiquitin thiolesterase protein OTUB2; hydrolase; 99.87
2zfy_A234 Ubiquitin thioesterase OTUB1; otubain, structural 99.86
4dhi_B284 Ubiquitin thioesterase otubain-like; ubiquitin E2 99.79
4ddg_A399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 99.7
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 97.62
2dhy_A67 CUE domain-containing protein 1; structural genomi 97.56
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 97.41
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 97.27
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 97.24
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 97.18
1wji_A63 Tudor domain containing protein 3; UBA domain, str 97.07
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 96.99
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 96.98
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 96.94
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 96.94
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 96.86
2dna_A67 Unnamed protein product; ubiquitin associated doma 96.84
1p3q_Q54 VPS9P, vacuolar protein sorting-associated protein 96.77
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 96.77
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 96.76
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 96.75
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 96.67
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 96.63
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 96.62
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 96.54
1tr8_A102 Conserved protein (MTH177); chaperones, nascent po 96.48
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 96.43
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 96.12
2cwb_A108 Chimera of immunoglobulin G binding protein G and 96.1
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 95.82
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 95.78
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 95.59
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 95.49
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 95.43
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 95.4
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 95.27
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 95.19
1vdl_A80 Ubiquitin carboxyl-terminal hydrolase 25; UBA doma 95.16
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 94.99
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 94.91
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 94.59
2lva_A129 Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubi 93.32
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 94.03
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 94.01
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 93.42
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 92.77
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 92.73
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 92.51
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 91.41
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 91.04
2di0_A71 Activating signal cointegrator 1 complex subunit 2 90.59
3dkb_A390 Tumor necrosis factor, alpha-induced protein 3; OT 90.31
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 90.12
3zrh_A454 Ubiquitin thioesterase zranb1; hydrolase, deubiqui 90.12
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 90.04
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 89.61
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 86.3
1ufz_A83 Hypothetical protein BAB28515; HBS1-like domain, s 85.28
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 84.86
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 82.95
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 82.16
>3pfy_A OTU domain-containing protein 5; structural genomics, structural genomics consortium, SGC, PE C65 otubain, hydrolase; HET: MSE PG4; 1.70A {Homo sapiens} PDB: 3tmp_A* 3tmo_A* Back     alignment and structure
Probab=99.93  E-value=1.7e-26  Score=186.68  Aligned_cols=91  Identities=21%  Similarity=0.371  Sum_probs=63.6

Q ss_pred             ChHHHHHhCccccccccCCCCCHHHHHHhhhcCCccCCHHHHHHHHhhcCccEEEEEccCCceEEe-ecccCCCcEEEEE
Q 029983            1 MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMSPRWYIR-NFDYHEARMIHLS   79 (184)
Q Consensus         1 lvv~yi~~n~d~F~pFv~~~~~f~~Y~~~m~k~g~WGg~iEL~Ala~~~~v~I~V~~~~~~~~~i~-~~~~~~~~~i~L~   79 (184)
                      +||+||++|+++|+|||++  +|++||++|+++++|||++||+|||++|+++|+|++.+++.+.+. +......++|+|+
T Consensus        92 ~vv~yi~~n~d~f~~Fv~~--~~e~Y~~~m~~~~~WGg~iEL~AlS~~~~v~I~V~~~~~~~i~i~~g~~~~~~~~I~L~  169 (185)
T 3pfy_A           92 HCMDYLMKNADYFSNYVTE--DFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVS  169 (185)
T ss_dssp             HHHHHHHHTHHHHTTCC-------------------CCHHHHHHHHHHHTSCEEEESSCSSCSEEECTTSCCTTSCEEEE
T ss_pred             HHHHHHHHHHHHHHHHHhc--cHHHHHHHhhCCCccchHHHHHHHHHhhCCcEEEEECCCCCeEEecCccCCCCCEEEEE
Confidence            4899999999999999985  899999999999999999999999999999999999987655443 3333457899999


Q ss_pred             EccCCcccceeccC
Q 029983           80 YHDGEHYNGVRLKE   93 (184)
Q Consensus        80 Y~~g~HYdSV~~~~   93 (184)
                      |+.++|||||+...
T Consensus       170 Y~~~~HYnSv~~p~  183 (185)
T 3pfy_A          170 YHRNIHYNSVVNPN  183 (185)
T ss_dssp             EETTTEEEEEECC-
T ss_pred             ECCCCCcccccCCC
Confidence            99999999998754



>3by4_A OTU1, ubiquitin thioesterase OTU1; ubiquitin hydrolase, deubiquitinase, cell cycle, hydrolase; 1.55A {Saccharomyces cerevisiae} PDB: 3c0r_A Back     alignment and structure
>3phu_A RNA-directed RNA polymerase L; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase; 2.20A {Crimean-congo hemorrhagic fever VIRUSIBAR10200} Back     alignment and structure
>3phx_A RNA-directed RNA polymerase L; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Crimean-congo hemorrhagic fever virus} PDB: 3phw_A 3pt2_A 3pse_A 3prp_A 3prm_A Back     alignment and structure
>1tff_A Ubiquitin thiolesterase protein OTUB2; hydrolase; 2.10A {Homo sapiens} SCOP: d.3.1.11 Back     alignment and structure
>2zfy_A Ubiquitin thioesterase OTUB1; otubain, structural genomics, structural genomics consortium, SGC, alternative splicing, hydrolase, immune response; 1.69A {Homo sapiens} PDB: 4ddg_B 4ddi_A Back     alignment and structure
>4dhi_B Ubiquitin thioesterase otubain-like; ubiquitin E2 enzyme fold, ubiquitination, hydrolase-ligase C; 1.80A {Caenorhabditis elegans} PDB: 4dhj_A 4dhz_A Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1p3q_Q VPS9P, vacuolar protein sorting-associated protein VPS9; trafficking, post translational modification, mono- ubiquitination; 1.70A {Saccharomyces cerevisiae} SCOP: a.5.2.4 PDB: 1mn3_A Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2lva_A Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubiquitin interacting motif, UBA domain, NESG, northeas structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>3dkb_A Tumor necrosis factor, alpha-induced protein 3; OTU domain, DUB domain, apoptosis, cytoplasm, DNA-binding, hydrolase, metal-binding, nucleus; 2.50A {Homo sapiens} PDB: 2vfj_A Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>3zrh_A Ubiquitin thioesterase zranb1; hydrolase, deubiquitinating enzyme, WNT signaling, ovarian T domain; 2.23A {Homo sapiens} Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>1ufz_A Hypothetical protein BAB28515; HBS1-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, translatio; NMR {Mus musculus} SCOP: a.5.9.1 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d1tffa_228 d.3.1.11 (A:) Ubiquitin thiolesterase protein OTUB 8e-17
d2dnaa150 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {M 0.002
>d1tffa_ d.3.1.11 (A:) Ubiquitin thiolesterase protein OTUB2 (Otubain-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Ubiquitin thiolesterase protein OTUB2 (Otubain-2)
domain: Ubiquitin thiolesterase protein OTUB2 (Otubain-2)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 73.1 bits (179), Expect = 8e-17
 Identities = 16/96 (16%), Positives = 38/96 (39%), Gaps = 4/96 (4%)

Query: 1   MVVQYIVKNRETFEPFIEDDVPFDEYCQS-METDGTWAGHMELQAASLVTHSNICIHRHM 59
           +   +I    + F  FI++++   ++C   +E   T   H+++ A S      + +    
Sbjct: 132 LTSAFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVD 191

Query: 60  SPRWYIRNFDYHE--ARMIHLSYHDGEHYNGVRLKE 93
                + +  + E     ++L Y    HYN +   +
Sbjct: 192 EMDTALNHHVFPEAATPSVYLLYKTS-HYNILYAAD 226


>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1tffa_228 Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 99.78
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 97.39
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 97.22
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 97.2
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.17
d1mn3a_54 Vacuolar protein sorting-associated protein vps9 { 97.11
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 97.08
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 97.07
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 96.9
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 96.89
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 96.89
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 96.73
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 96.65
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 96.64
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 96.64
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 96.57
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 96.46
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 95.99
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 95.35
d1vdla_80 Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M 94.3
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 94.13
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 89.73
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 89.5
d2cp8a141 Migration-inducing protein 19 NBR1 {Human (Homo sa 84.72
d2di0a163 Activating signal cointegrator 1 complex subunit 2 83.52
d1ufza_83 HBS1-like protein {Mouse (Mus musculus) [TaxId: 10 82.13
d1umqa_60 Photosynthetic apparatus regulatory protein PprA ( 80.27
>d1tffa_ d.3.1.11 (A:) Ubiquitin thiolesterase protein OTUB2 (Otubain-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Ubiquitin thiolesterase protein OTUB2 (Otubain-2)
domain: Ubiquitin thiolesterase protein OTUB2 (Otubain-2)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.78  E-value=9.3e-20  Score=148.82  Aligned_cols=92  Identities=17%  Similarity=0.315  Sum_probs=77.3

Q ss_pred             ChHHHHHhCccccccccCCCCCHHHHHHh-hhcCCccCCHHHHHHHHhhcCccEEEEEccCCceEE--eecccCCCcEEE
Q 029983            1 MVVQYIVKNRETFEPFIEDDVPFDEYCQS-METDGTWAGHMELQAASLVTHSNICIHRHMSPRWYI--RNFDYHEARMIH   77 (184)
Q Consensus         1 lvv~yi~~n~d~F~pFv~~~~~f~~Y~~~-m~k~g~WGg~iEL~Ala~~~~v~I~V~~~~~~~~~i--~~~~~~~~~~i~   77 (184)
                      |++.||+.|++.|.||++++.++++||.+ |.++++||||+||+|||++|+++|.|+.++.+...+  ..+++...++|+
T Consensus       132 l~s~~i~~~~~~y~~Fi~~~~~~~~yc~~~v~~~~~e~d~ieI~aLa~al~v~I~V~~~d~~~~~~~~~~~~~~~~~~I~  211 (228)
T d1tffa_         132 LTSAFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVY  211 (228)
T ss_dssp             HHHHHHHHTHHHHGGGSCTTSCHHHHHHHHTSSTTCCCCHHHHHHHHHHHTCCEEEEECC-------CCCCCCCSSCSEE
T ss_pred             HHHHHHHHCHHHHHhHhcCCccHHHHHHHHHccccccCCcHHHHHHHHHhCCCEEEEEecCCCCccccccCCCCCCCEEE
Confidence            47899999999999999988899999986 999999999999999999999999999987754444  235556678899


Q ss_pred             EEEccCCcccceeccC
Q 029983           78 LSYHDGEHYNGVRLKE   93 (184)
Q Consensus        78 L~Y~~g~HYdSV~~~~   93 (184)
                      |+|.+| |||+|++.+
T Consensus       212 Lly~pg-HYdiLY~~~  226 (228)
T d1tffa_         212 LLYKTS-HYNILYAAD  226 (228)
T ss_dssp             EEEETT-EEEEEEECC
T ss_pred             EEeCCC-CcccCccCC
Confidence            999765 999999875



>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2di0a1 a.5.2.4 (A:8-70) Activating signal cointegrator 1 complex subunit 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufza_ a.5.9.1 (A:) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure