Citrus Sinensis ID: 029990
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 184 | ||||||
| 296082384 | 385 | unnamed protein product [Vitis vinifera] | 0.967 | 0.462 | 0.772 | 7e-78 | |
| 225438775 | 467 | PREDICTED: OTU domain-containing protein | 0.967 | 0.381 | 0.772 | 1e-77 | |
| 356565555 | 382 | PREDICTED: OTU domain-containing protein | 0.983 | 0.473 | 0.754 | 2e-77 | |
| 224081718 | 349 | predicted protein [Populus trichocarpa] | 0.983 | 0.518 | 0.741 | 2e-76 | |
| 255565284 | 371 | OTU domain-containing protein, putative | 0.978 | 0.485 | 0.736 | 7e-76 | |
| 23306370 | 375 | putative protein [Arabidopsis thaliana] | 0.978 | 0.48 | 0.703 | 3e-73 | |
| 30698282 | 375 | SEC-C motif-containing protein / OTU-lik | 0.978 | 0.48 | 0.703 | 5e-73 | |
| 42573818 | 374 | SEC-C motif-containing protein / OTU-lik | 0.978 | 0.481 | 0.703 | 5e-73 | |
| 10177604 | 382 | unnamed protein product [Arabidopsis tha | 0.978 | 0.471 | 0.703 | 7e-73 | |
| 297797661 | 374 | hypothetical protein ARALYDRAFT_496882 [ | 0.961 | 0.473 | 0.720 | 2e-72 |
| >gi|296082384|emb|CBI21389.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 295 bits (754), Expect = 7e-78, Method: Compositional matrix adjust.
Identities = 139/180 (77%), Positives = 156/180 (86%), Gaps = 2/180 (1%)
Query: 1 MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMS 60
MVV+YI++NR+ FEPFIEDDVPFD+YCQSME DGTWAGHMELQAASLVT SNICIHRHMS
Sbjct: 72 MVVRYILENRDMFEPFIEDDVPFDDYCQSMEKDGTWAGHMELQAASLVTRSNICIHRHMS 131
Query: 61 PRWYIRNFDYHEARMIHLSYHDGEHYNGVRLKEDSCIGSARPIIIKADADISAASIQSKT 120
PRWYI+NF+ ARMIHLSYHDGEHYN VRLKED C G ARPIIIKAD D+S AS Q K
Sbjct: 132 PRWYIQNFNASGARMIHLSYHDGEHYNSVRLKEDPCDGPARPIIIKADTDLSVASHQVKG 191
Query: 121 VTSKLKGAAG--IINAGSIKLVMAGSGCENSEKVEEVLLQVGGDVDAAIEFLIAEQGTEE 178
+SK K AG II+AGSIKLVM GSGCEN+EKVE+VL+++ GDVDAAIE+LIAE+ TEE
Sbjct: 192 ASSKSKSGAGRNIIDAGSIKLVMVGSGCENAEKVEQVLVELSGDVDAAIEYLIAERETEE 251
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225438775|ref|XP_002278347.1| PREDICTED: OTU domain-containing protein 3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356565555|ref|XP_003551005.1| PREDICTED: OTU domain-containing protein 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224081718|ref|XP_002306480.1| predicted protein [Populus trichocarpa] gi|222855929|gb|EEE93476.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255565284|ref|XP_002523634.1| OTU domain-containing protein, putative [Ricinus communis] gi|223537196|gb|EEF38829.1| OTU domain-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|23306370|gb|AAN17412.1| putative protein [Arabidopsis thaliana] gi|25084238|gb|AAN72203.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|30698282|ref|NP_201518.2| SEC-C motif-containing protein / OTU-like cysteine protease family protein [Arabidopsis thaliana] gi|332010926|gb|AED98309.1| SEC-C motif-containing protein / OTU-like cysteine protease family protein [Arabidopsis thaliana] gi|407078848|gb|AFS88955.1| OTU-containing deubiquitinating enzyme OTU7 isoform i [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42573818|ref|NP_975005.1| SEC-C motif-containing protein / OTU-like cysteine protease family protein [Arabidopsis thaliana] gi|332010927|gb|AED98310.1| SEC-C motif-containing protein / OTU-like cysteine protease family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|10177604|dbj|BAB10951.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297797661|ref|XP_002866715.1| hypothetical protein ARALYDRAFT_496882 [Arabidopsis lyrata subsp. lyrata] gi|297312550|gb|EFH42974.1| hypothetical protein ARALYDRAFT_496882 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 184 | ||||||
| TAIR|locus:2155588 | 375 | AT5G67170 [Arabidopsis thalian | 0.961 | 0.472 | 0.670 | 2.1e-61 | |
| DICTYBASE|DDB_G0267906 | 438 | DDB_G0267906 "OTU domain conta | 0.483 | 0.203 | 0.510 | 4.6e-24 | |
| ZFIN|ZDB-GENE-040426-2509 | 357 | otud3 "OTU domain containing 3 | 0.505 | 0.260 | 0.344 | 9.8e-13 | |
| GENEDB_PFALCIPARUM|PF10_0308 | 938 | PF10_0308 "OTU-like cysteine p | 0.489 | 0.095 | 0.362 | 1.4e-10 | |
| UNIPROTKB|Q8IJ91 | 938 | PF10_0308 "OTU-like cysteine p | 0.489 | 0.095 | 0.362 | 1.4e-10 | |
| UNIPROTKB|Q01804 | 1113 | OTUD4 "OTU domain-containing p | 0.489 | 0.080 | 0.32 | 7.2e-07 | |
| MGI|MGI:1098801 | 1107 | Otud4 "OTU domain containing 4 | 0.434 | 0.072 | 0.321 | 2.8e-05 | |
| DICTYBASE|DDB_G0279375 | 340 | DDB_G0279375 "OTU domain conta | 0.434 | 0.235 | 0.385 | 0.00014 | |
| ASPGD|ASPL0000061651 | 472 | AN0173 [Emericella nidulans (t | 0.755 | 0.294 | 0.259 | 0.00023 | |
| UNIPROTKB|G4NEZ8 | 304 | MGG_11505 "Uncharacterized pro | 0.456 | 0.276 | 0.319 | 0.00038 |
| TAIR|locus:2155588 AT5G67170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 628 (226.1 bits), Expect = 2.1e-61, P = 2.1e-61
Identities = 120/179 (67%), Positives = 139/179 (77%)
Query: 1 MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMS 60
M+V YIVKNRE FEPFIEDDVPF++YC++M+ DGTWAG+MELQAASLVT SNICIHR+MS
Sbjct: 70 MIVLYIVKNREMFEPFIEDDVPFEDYCKTMDDDGTWAGNMELQAASLVTRSNICIHRNMS 129
Query: 61 PRWYIRNFDYHEARMIHLSYHDGEHYNGVRLKEDSCIGSARPXXXXXXXXXXXXXXQSKT 120
PRWYIRNF+ RMIHLSYHDGEHYN VR KED+C G ARP Q+K
Sbjct: 130 PRWYIRNFEDTRTRMIHLSYHDGEHYNSVRSKEDACGGPARPVVIEADAKVSAASKQAKA 189
Query: 121 VTSKLKGAAGI--INAGSIKLVMAGSGCENSEKVEEVLLQVGGDVDAAIEFLIAEQGTE 177
SK K A +NAG+IK+VM+GS C+N+EK E+VLLQV GDVDAAIEFLIA+QG E
Sbjct: 190 TESKSKNKADKCHVNAGAIKVVMSGSCCDNTEKAEQVLLQVNGDVDAAIEFLIADQGME 248
|
|
| DICTYBASE|DDB_G0267906 DDB_G0267906 "OTU domain containin protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2509 otud3 "OTU domain containing 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF10_0308 PF10_0308 "OTU-like cysteine protease, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IJ91 PF10_0308 "OTU-like cysteine protease, putative" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q01804 OTUD4 "OTU domain-containing protein 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1098801 Otud4 "OTU domain containing 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0279375 DDB_G0279375 "OTU domain containin protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000061651 AN0173 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NEZ8 MGG_11505 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_V000542 | hypothetical protein (349 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 184 | |||
| pfam02338 | 123 | pfam02338, OTU, OTU-like cysteine protease | 7e-14 | |
| pfam10275 | 237 | pfam10275, Peptidase_C65, Peptidase C65 Otubain | 6e-05 |
| >gnl|CDD|216981 pfam02338, OTU, OTU-like cysteine protease | Back alignment and domain information |
|---|
Score = 64.5 bits (157), Expect = 7e-14
Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 12/96 (12%)
Query: 1 MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMS 60
VV+Y+ +NRE FE F+E+D +EY + + DG W G++E+ A + + I +++
Sbjct: 30 AVVEYLRENREDFEKFLEED--ENEYYKWISKDGAWGGNIEIFALAHILRVPIIVYKLQG 87
Query: 61 PR--WYIRNFDYHE----ARMIHLSYH----DGEHY 86
R YI+ + + +I LSY G HY
Sbjct: 88 GRITVYIKIYGTYLPLNKKPVIRLSYLGLEYTGNHY 123
|
This family is comprised of a group of predicted cysteine proteases, homologous to the Ovarian Tumour (OTU) gene in Drosophila. Members include proteins from eukaryotes, viruses and pathogenic bacterium. The conserved cysteine and histidine, and possibly the aspartate, represent the catalytic residues in this putative group of proteases. Length = 123 |
| >gnl|CDD|220671 pfam10275, Peptidase_C65, Peptidase C65 Otubain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 184 | |||
| KOG2606 | 302 | consensus OTU (ovarian tumor)-like cysteine protea | 99.85 | |
| KOG3288 | 307 | consensus OTU-like cysteine protease [Signal trans | 99.51 | |
| PF02338 | 121 | OTU: OTU-like cysteine protease; InterPro: IPR0033 | 99.5 | |
| KOG3991 | 256 | consensus Uncharacterized conserved protein [Funct | 99.36 | |
| PF10275 | 244 | Peptidase_C65: Peptidase C65 Otubain; InterPro: IP | 99.34 | |
| KOG2605 | 371 | consensus OTU (ovarian tumor)-like cysteine protea | 98.45 | |
| COG5539 | 306 | Predicted cysteine protease (OTU family) [Posttran | 98.42 | |
| COG5539 | 306 | Predicted cysteine protease (OTU family) [Posttran | 98.24 | |
| PF02845 | 42 | CUE: CUE domain; InterPro: IPR003892 This domain m | 97.55 | |
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 97.42 | |
| PF14555 | 43 | UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A | 97.29 | |
| smart00546 | 43 | CUE Domain that may be involved in binding ubiquit | 97.01 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 96.97 | |
| TIGR00264 | 116 | alpha-NAC-related protein. This hypothetical prote | 96.94 | |
| PRK06369 | 115 | nac nascent polypeptide-associated complex protein | 96.88 | |
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 96.42 | |
| COG1308 | 122 | EGD2 Transcription factor homologous to NACalpha-B | 95.31 | |
| PF06972 | 60 | DUF1296: Protein of unknown function (DUF1296); In | 95.17 | |
| PF03474 | 39 | DMA: DMRTA motif; InterPro: IPR005173 This region | 93.94 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 88.8 | |
| PF08938 | 79 | HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This | 84.08 | |
| PF02954 | 42 | HTH_8: Bacterial regulatory protein, Fis family; I | 81.56 |
| >KOG2606 consensus OTU (ovarian tumor)-like cysteine protease [Signal transduction mechanisms; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.85 E-value=5.3e-22 Score=169.30 Aligned_cols=91 Identities=31% Similarity=0.582 Sum_probs=79.8
Q ss_pred ChHHHHHhCccccccccCCC--------CCHHHHHHhhhcCCccCCHHHHHHHHhhcCccEEEEEccCCceEEee-cccC
Q 029990 1 MVVQYIVKNRETFEPFIEDD--------VPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMSPRWYIRN-FDYH 71 (184)
Q Consensus 1 lvv~yi~~n~d~F~pFv~~~--------~~f~~Y~~~m~k~g~WGg~iEL~Ala~~~~v~I~V~~~~~~~~~i~~-~~~~ 71 (184)
++|+||++|.++|.||+.++ .+|+.||+.|+.++.|||++||.|||.+|++||.||+.++|...++. |.
T Consensus 195 ~~a~Ymr~H~~df~pf~~~eet~d~~~~~~f~~Yc~eI~~t~~WGgelEL~AlShvL~~PI~Vy~~~~p~~~~geey~-- 272 (302)
T KOG2606|consen 195 ETADYMREHVEDFLPFLLDEETGDSLGPEDFDKYCREIRNTAAWGGELELKALSHVLQVPIEVYQADGPILEYGEEYG-- 272 (302)
T ss_pred HHHHHHHHHHHHhhhHhcCccccccCCHHHHHHHHHHhhhhccccchHHHHHHHHhhccCeEEeecCCCceeechhhC--
Confidence 47999999999999999864 25999999999999999999999999999999999999998776653 32
Q ss_pred CCcEEEEEEc-----cCCcccceeccC
Q 029990 72 EARMIHLSYH-----DGEHYNGVRLKE 93 (184)
Q Consensus 72 ~~~~i~L~Y~-----~g~HYdSV~~~~ 93 (184)
+.++|.|+|| .|+||||+.+..
T Consensus 273 kd~pL~lvY~rH~y~LGeHYNS~~~~~ 299 (302)
T KOG2606|consen 273 KDKPLILVYHRHAYGLGEHYNSVTPLK 299 (302)
T ss_pred CCCCeeeehHHhHHHHHhhhccccccc
Confidence 2579999998 499999998754
|
|
| >KOG3288 consensus OTU-like cysteine protease [Signal transduction mechanisms; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02338 OTU: OTU-like cysteine protease; InterPro: IPR003323 This is a group of proteins found primarily in viruses, eukaryotes and in the pathogenic bacterium Chlamydia pneumoniae | Back alignment and domain information |
|---|
| >KOG3991 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10275 Peptidase_C65: Peptidase C65 Otubain; InterPro: IPR019400 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG2605 consensus OTU (ovarian tumor)-like cysteine protease [Signal transduction mechanisms; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5539 Predicted cysteine protease (OTU family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5539 Predicted cysteine protease (OTU family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A | Back alignment and domain information |
|---|
| >smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >TIGR00264 alpha-NAC-related protein | Back alignment and domain information |
|---|
| >PRK06369 nac nascent polypeptide-associated complex protein; Reviewed | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription] | Back alignment and domain information |
|---|
| >PF06972 DUF1296: Protein of unknown function (DUF1296); InterPro: IPR009719 This family represents a conserved region approximately 60 residues long within a number of plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF03474 DMA: DMRTA motif; InterPro: IPR005173 This region is found to the C terminus of the DM DNA-binding domain IPR001275 from INTERPRO [] | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >PF08938 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This domain is found in various eukaryotic HBS1-like proteins | Back alignment and domain information |
|---|
| >PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 184 | |||
| 3pfy_A | 185 | OTU domain-containing protein 5; structural genomi | 4e-24 | |
| 3phx_A | 185 | RNA-directed RNA polymerase L; OTU domain, DE-ubiq | 3e-22 | |
| 3phu_A | 219 | RNA-directed RNA polymerase L; OTU domain, DE-ubiq | 4e-21 | |
| 3by4_A | 212 | OTU1, ubiquitin thioesterase OTU1; ubiquitin hydro | 3e-19 | |
| 2zfy_A | 234 | Ubiquitin thioesterase OTUB1; otubain, structural | 4e-13 | |
| 1tff_A | 234 | Ubiquitin thiolesterase protein OTUB2; hydrolase; | 4e-10 | |
| 4dhi_B | 284 | Ubiquitin thioesterase otubain-like; ubiquitin E2 | 4e-08 |
| >3pfy_A OTU domain-containing protein 5; structural genomics, structural genomics consortium, SGC, PE C65 otubain, hydrolase; HET: MSE PG4; 1.70A {Homo sapiens} PDB: 3tmp_A* 3tmo_A* Length = 185 | Back alignment and structure |
|---|
Score = 92.5 bits (229), Expect = 4e-24
Identities = 20/96 (20%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
Query: 1 MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMS 60
+ Y++KN + F ++ +D F Y + H+E+QA + + + + ++++ +
Sbjct: 92 HCMDYLMKNADYFSNYVTED--FTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYST 149
Query: 61 PRW-YIRNFDYHEARMIHLSYHDGEHYNGVRLKEDS 95
+E I +SYH HYN V +
Sbjct: 150 EPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKA 185
|
| >3phx_A RNA-directed RNA polymerase L; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Crimean-congo hemorrhagic fever virus} PDB: 3phw_A 3pt2_A 3pse_A 3prp_A 3prm_A Length = 185 | Back alignment and structure |
|---|
| >3phu_A RNA-directed RNA polymerase L; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase; 2.20A {Crimean-congo hemorrhagic fever VIRUSIBAR10200} Length = 219 | Back alignment and structure |
|---|
| >3by4_A OTU1, ubiquitin thioesterase OTU1; ubiquitin hydrolase, deubiquitinase, cell cycle, hydrolase; 1.55A {Saccharomyces cerevisiae} PDB: 3c0r_A Length = 212 | Back alignment and structure |
|---|
| >2zfy_A Ubiquitin thioesterase OTUB1; otubain, structural genomics, structural genomics consortium, SGC, alternative splicing, hydrolase, immune response; 1.69A {Homo sapiens} PDB: 4ddg_B 4ddi_A Length = 234 | Back alignment and structure |
|---|
| >1tff_A Ubiquitin thiolesterase protein OTUB2; hydrolase; 2.10A {Homo sapiens} SCOP: d.3.1.11 Length = 234 | Back alignment and structure |
|---|
| >4dhi_B Ubiquitin thioesterase otubain-like; ubiquitin E2 enzyme fold, ubiquitination, hydrolase-ligase C; 1.80A {Caenorhabditis elegans} PDB: 4dhj_A 4dhz_A Length = 284 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 184 | |||
| 3pfy_A | 185 | OTU domain-containing protein 5; structural genomi | 99.93 | |
| 3by4_A | 212 | OTU1, ubiquitin thioesterase OTU1; ubiquitin hydro | 99.91 | |
| 3phu_A | 219 | RNA-directed RNA polymerase L; OTU domain, DE-ubiq | 99.9 | |
| 3phx_A | 185 | RNA-directed RNA polymerase L; OTU domain, DE-ubiq | 99.9 | |
| 1tff_A | 234 | Ubiquitin thiolesterase protein OTUB2; hydrolase; | 99.87 | |
| 2zfy_A | 234 | Ubiquitin thioesterase OTUB1; otubain, structural | 99.86 | |
| 4dhi_B | 284 | Ubiquitin thioesterase otubain-like; ubiquitin E2 | 99.79 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 99.7 | |
| 1wgl_A | 59 | TOLL-interacting protein; CUE domain, structural g | 97.62 | |
| 2dhy_A | 67 | CUE domain-containing protein 1; structural genomi | 97.56 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 97.41 | |
| 2cp9_A | 64 | EF-TS, EF-TSMT, elongation factor TS, mitochondria | 97.27 | |
| 2bwb_A | 46 | Ubiquitin-like protein DSK2; UBA, signaling protei | 97.24 | |
| 1otr_A | 49 | Protein CUE2; protein-protein complex, cell cycle; | 97.18 | |
| 1wji_A | 63 | Tudor domain containing protein 3; UBA domain, str | 97.07 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 96.99 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 96.98 | |
| 1wr1_B | 58 | Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu | 96.94 | |
| 2dah_A | 54 | Ubiquilin-3; UBA domain, structural genomics, NPPS | 96.94 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 96.86 | |
| 2dna_A | 67 | Unnamed protein product; ubiquitin associated doma | 96.84 | |
| 1p3q_Q | 54 | VPS9P, vacuolar protein sorting-associated protein | 96.77 | |
| 1vej_A | 74 | Riken cDNA 4931431F19; UBA domain, three helix bun | 96.77 | |
| 2jy5_A | 52 | Ubiquilin-1; UBA, alternative splicing, cytoplasm, | 96.76 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 96.75 | |
| 2cp8_A | 54 | NEXT to BRCA1 gene 1 protein; UBA domain, structur | 96.67 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 96.63 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 96.62 | |
| 3e21_A | 45 | HFAF1, FAS-associated factor 1; UBA, alternative s | 96.54 | |
| 1tr8_A | 102 | Conserved protein (MTH177); chaperones, nascent po | 96.48 | |
| 2dam_A | 67 | ETEA protein; KIAA0887, UBA-like domain, structura | 96.43 | |
| 1wiv_A | 73 | UBP14, ubiquitin-specific protease 14; ubiquitin a | 96.12 | |
| 2cwb_A | 108 | Chimera of immunoglobulin G binding protein G and | 96.1 | |
| 1veg_A | 83 | NEDD8 ultimate buster-1; ubiquitin associated doma | 95.82 | |
| 1whc_A | 64 | RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain | 95.78 | |
| 1v92_A | 46 | NSFL1 cofactor P47; 3-helix bundle, recombination; | 95.59 | |
| 2dal_A | 62 | Protein KIAA0794; FAS associted factor 1, UBA-like | 95.49 | |
| 2dag_A | 74 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 95.43 | |
| 1dv0_A | 47 | DNA repair protein HHR23A; helical bundle, DNA bin | 95.4 | |
| 2ekk_A | 47 | UBA domain from E3 ubiquitin-protein ligase HUWE1; | 95.27 | |
| 2dai_A | 83 | Ubadc1, ubiquitin associated domain containing 1; | 95.19 | |
| 1vdl_A | 80 | Ubiquitin carboxyl-terminal hydrolase 25; UBA doma | 95.16 | |
| 1wgn_A | 63 | UBAP1, ubiquitin associated protein; ubiquitin ass | 94.99 | |
| 2cpw_A | 64 | CBL-interacting protein STS-1 variant; ubiquitin a | 94.91 | |
| 2crn_A | 64 | Ubash3A protein; compact three-helix bundle, struc | 94.59 | |
| 2lva_A | 129 | Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubi | 93.32 | |
| 2ooa_A | 52 | E3 ubiquitin-protein ligase CBL-B; alpha-helical d | 94.03 | |
| 2dkl_A | 85 | Trinucleotide repeat containing 6C protein; TNRC6C | 94.01 | |
| 2d9s_A | 53 | CBL E3 ubiquitin protein ligase; UBA domain, dimer | 93.42 | |
| 2dzl_A | 66 | Protein FAM100B; UBA-like domain, structural genom | 92.77 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 92.73 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 92.51 | |
| 1vek_A | 84 | UBP14, ubiquitin-specific protease 14, putative; U | 91.41 | |
| 2oo9_A | 46 | E3 ubiquitin-protein ligase CBL; alpha-helical dom | 91.04 | |
| 2di0_A | 71 | Activating signal cointegrator 1 complex subunit 2 | 90.59 | |
| 3dkb_A | 390 | Tumor necrosis factor, alpha-induced protein 3; OT | 90.31 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 90.12 | |
| 3zrh_A | 454 | Ubiquitin thioesterase zranb1; hydrolase, deubiqui | 90.12 | |
| 2juj_A | 56 | E3 ubiquitin-protein ligase CBL; alpha helix, UBA | 90.04 | |
| 2qsf_X | 171 | RAD23, UV excision repair protein RAD23; alpha-bet | 89.61 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 86.3 | |
| 1ufz_A | 83 | Hypothetical protein BAB28515; HBS1-like domain, s | 85.28 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 84.86 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 82.95 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 82.16 |
| >3pfy_A OTU domain-containing protein 5; structural genomics, structural genomics consortium, SGC, PE C65 otubain, hydrolase; HET: MSE PG4; 1.70A {Homo sapiens} PDB: 3tmp_A* 3tmo_A* | Back alignment and structure |
|---|
Probab=99.93 E-value=1.7e-26 Score=186.68 Aligned_cols=91 Identities=21% Similarity=0.371 Sum_probs=63.6
Q ss_pred ChHHHHHhCccccccccCCCCCHHHHHHhhhcCCccCCHHHHHHHHhhcCccEEEEEccCCceEEe-ecccCCCcEEEEE
Q 029990 1 MVVQYIVKNRETFEPFIEDDVPFDEYCQSMETDGTWAGHMELQAASLVTHSNICIHRHMSPRWYIR-NFDYHEARMIHLS 79 (184)
Q Consensus 1 lvv~yi~~n~d~F~pFv~~~~~f~~Y~~~m~k~g~WGg~iEL~Ala~~~~v~I~V~~~~~~~~~i~-~~~~~~~~~i~L~ 79 (184)
+||+||++|+++|+|||++ +|++||++|+++++|||++||+|||++|+++|+|++.+++.+.+. +......++|+|+
T Consensus 92 ~vv~yi~~n~d~f~~Fv~~--~~e~Y~~~m~~~~~WGg~iEL~AlS~~~~v~I~V~~~~~~~i~i~~g~~~~~~~~I~L~ 169 (185)
T 3pfy_A 92 HCMDYLMKNADYFSNYVTE--DFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVS 169 (185)
T ss_dssp HHHHHHHHTHHHHTTCC-------------------CCHHHHHHHHHHHTSCEEEESSCSSCSEEECTTSCCTTSCEEEE
T ss_pred HHHHHHHHHHHHHHHHHhc--cHHHHHHHhhCCCccchHHHHHHHHHhhCCcEEEEECCCCCeEEecCccCCCCCEEEEE
Confidence 4899999999999999985 899999999999999999999999999999999999987655443 3333457899999
Q ss_pred EccCCcccceeccC
Q 029990 80 YHDGEHYNGVRLKE 93 (184)
Q Consensus 80 Y~~g~HYdSV~~~~ 93 (184)
|+.++|||||+...
T Consensus 170 Y~~~~HYnSv~~p~ 183 (185)
T 3pfy_A 170 YHRNIHYNSVVNPN 183 (185)
T ss_dssp EETTTEEEEEECC-
T ss_pred ECCCCCcccccCCC
Confidence 99999999998754
|
| >3by4_A OTU1, ubiquitin thioesterase OTU1; ubiquitin hydrolase, deubiquitinase, cell cycle, hydrolase; 1.55A {Saccharomyces cerevisiae} PDB: 3c0r_A | Back alignment and structure |
|---|
| >3phu_A RNA-directed RNA polymerase L; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase; 2.20A {Crimean-congo hemorrhagic fever VIRUSIBAR10200} | Back alignment and structure |
|---|
| >3phx_A RNA-directed RNA polymerase L; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Crimean-congo hemorrhagic fever virus} PDB: 3phw_A 3pt2_A 3pse_A 3prp_A 3prm_A | Back alignment and structure |
|---|
| >1tff_A Ubiquitin thiolesterase protein OTUB2; hydrolase; 2.10A {Homo sapiens} SCOP: d.3.1.11 | Back alignment and structure |
|---|
| >2zfy_A Ubiquitin thioesterase OTUB1; otubain, structural genomics, structural genomics consortium, SGC, alternative splicing, hydrolase, immune response; 1.69A {Homo sapiens} PDB: 4ddg_B 4ddi_A | Back alignment and structure |
|---|
| >4dhi_B Ubiquitin thioesterase otubain-like; ubiquitin E2 enzyme fold, ubiquitination, hydrolase-ligase C; 1.80A {Caenorhabditis elegans} PDB: 4dhj_A 4dhz_A | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A | Back alignment and structure |
|---|
| >1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 | Back alignment and structure |
|---|
| >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A | Back alignment and structure |
|---|
| >1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1p3q_Q VPS9P, vacuolar protein sorting-associated protein VPS9; trafficking, post translational modification, mono- ubiquitination; 1.70A {Saccharomyces cerevisiae} SCOP: a.5.2.4 PDB: 1mn3_A | Back alignment and structure |
|---|
| >1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B | Back alignment and structure |
|---|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} | Back alignment and structure |
|---|
| >2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A | Back alignment and structure |
|---|
| >1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A | Back alignment and structure |
|---|
| >2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2lva_A Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubiquitin interacting motif, UBA domain, NESG, northeas structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A | Back alignment and structure |
|---|
| >2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >3dkb_A Tumor necrosis factor, alpha-induced protein 3; OTU domain, DUB domain, apoptosis, cytoplasm, DNA-binding, hydrolase, metal-binding, nucleus; 2.50A {Homo sapiens} PDB: 2vfj_A | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >3zrh_A Ubiquitin thioesterase zranb1; hydrolase, deubiquitinating enzyme, WNT signaling, ovarian T domain; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ufz_A Hypothetical protein BAB28515; HBS1-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, translatio; NMR {Mus musculus} SCOP: a.5.9.1 | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 184 | ||||
| d1tffa_ | 228 | d.3.1.11 (A:) Ubiquitin thiolesterase protein OTUB | 8e-17 | |
| d2dnaa1 | 50 | a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {M | 0.002 |
| >d1tffa_ d.3.1.11 (A:) Ubiquitin thiolesterase protein OTUB2 (Otubain-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) domain: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) species: Human (Homo sapiens) [TaxId: 9606]
Score = 73.1 bits (179), Expect = 8e-17
Identities = 16/96 (16%), Positives = 38/96 (39%), Gaps = 4/96 (4%)
Query: 1 MVVQYIVKNRETFEPFIEDDVPFDEYCQS-METDGTWAGHMELQAASLVTHSNICIHRHM 59
+ +I + F FI++++ ++C +E T H+++ A S + +
Sbjct: 132 LTSAFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVD 191
Query: 60 SPRWYIRNFDYHE--ARMIHLSYHDGEHYNGVRLKE 93
+ + + E ++L Y HYN + +
Sbjct: 192 EMDTALNHHVFPEAATPSVYLLYKTS-HYNILYAAD 226
|
| >d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 184 | |||
| d1tffa_ | 228 | Ubiquitin thiolesterase protein OTUB2 (Otubain-2) | 99.78 | |
| d1wgla_ | 59 | Toll-interacting protein {Human (Homo sapiens) [Ta | 97.39 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 97.22 | |
| d2daha1 | 41 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 97.2 | |
| d2bwba1 | 44 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 97.17 | |
| d1mn3a_ | 54 | Vacuolar protein sorting-associated protein vps9 { | 97.11 | |
| d2dnaa1 | 50 | Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus | 97.08 | |
| d1wj7a1 | 91 | Ubiquitin-associated protein 2-like Ubap2l {Mouse | 97.07 | |
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 96.9 | |
| d1veja1 | 61 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 96.89 | |
| d1wgna_ | 63 | Ubiquitin-associated protein 1, UBAP1 {Human (Homo | 96.89 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 96.73 | |
| d1efub3 | 54 | Elongation factor Ts (EF-Ts), N-terminal domain {E | 96.65 | |
| d1v92a_ | 46 | NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { | 96.64 | |
| d1wiva_ | 73 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 96.64 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 96.57 | |
| d1xb2b1 | 56 | Elongation factor Ts (EF-Ts), N-terminal domain {C | 96.46 | |
| d1aipc1 | 52 | Elongation factor Ts (EF-Ts), N-terminal domain {T | 95.99 | |
| d1whca_ | 64 | UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta | 95.35 | |
| d1vdla_ | 80 | Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M | 94.3 | |
| d2cpwa1 | 51 | Cbl-interacting protein p70, STS1 {Human (Homo sap | 94.13 | |
| d2crna1 | 51 | Suppressor of T-cell receptor signaling 2 (STS-2) | 89.73 | |
| d1veka_ | 84 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 89.5 | |
| d2cp8a1 | 41 | Migration-inducing protein 19 NBR1 {Human (Homo sa | 84.72 | |
| d2di0a1 | 63 | Activating signal cointegrator 1 complex subunit 2 | 83.52 | |
| d1ufza_ | 83 | HBS1-like protein {Mouse (Mus musculus) [TaxId: 10 | 82.13 | |
| d1umqa_ | 60 | Photosynthetic apparatus regulatory protein PprA ( | 80.27 |
| >d1tffa_ d.3.1.11 (A:) Ubiquitin thiolesterase protein OTUB2 (Otubain-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) domain: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.78 E-value=9.3e-20 Score=148.82 Aligned_cols=92 Identities=17% Similarity=0.315 Sum_probs=77.3
Q ss_pred ChHHHHHhCccccccccCCCCCHHHHHHh-hhcCCccCCHHHHHHHHhhcCccEEEEEccCCceEE--eecccCCCcEEE
Q 029990 1 MVVQYIVKNRETFEPFIEDDVPFDEYCQS-METDGTWAGHMELQAASLVTHSNICIHRHMSPRWYI--RNFDYHEARMIH 77 (184)
Q Consensus 1 lvv~yi~~n~d~F~pFv~~~~~f~~Y~~~-m~k~g~WGg~iEL~Ala~~~~v~I~V~~~~~~~~~i--~~~~~~~~~~i~ 77 (184)
|++.||+.|++.|.||++++.++++||.+ |.++++||||+||+|||++|+++|.|+.++.+...+ ..+++...++|+
T Consensus 132 l~s~~i~~~~~~y~~Fi~~~~~~~~yc~~~v~~~~~e~d~ieI~aLa~al~v~I~V~~~d~~~~~~~~~~~~~~~~~~I~ 211 (228)
T d1tffa_ 132 LTSAFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVY 211 (228)
T ss_dssp HHHHHHHHTHHHHGGGSCTTSCHHHHHHHHTSSTTCCCCHHHHHHHHHHHTCCEEEEECC-------CCCCCCCSSCSEE
T ss_pred HHHHHHHHCHHHHHhHhcCCccHHHHHHHHHccccccCCcHHHHHHHHHhCCCEEEEEecCCCCccccccCCCCCCCEEE
Confidence 47899999999999999988899999986 999999999999999999999999999987754444 235556678899
Q ss_pred EEEccCCcccceeccC
Q 029990 78 LSYHDGEHYNGVRLKE 93 (184)
Q Consensus 78 L~Y~~g~HYdSV~~~~ 93 (184)
|+|.+| |||+|++.+
T Consensus 212 Lly~pg-HYdiLY~~~ 226 (228)
T d1tffa_ 212 LLYKTS-HYNILYAAD 226 (228)
T ss_dssp EEEETT-EEEEEEECC
T ss_pred EEeCCC-CcccCccCC
Confidence 999765 999999875
|
| >d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2di0a1 a.5.2.4 (A:8-70) Activating signal cointegrator 1 complex subunit 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufza_ a.5.9.1 (A:) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|