Citrus Sinensis ID: 029997


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MKITALLVLKCNPDGSDPVVLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRNGLCVMGFMDDHYPVRSSFSLLNQVLDEYQKNFGESWRTAQADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQT
cEEEEEEEEEcccccccccEEEEEECcccccHHHHHHHHHHHHHHHHHHHccccccccEEEECccEEEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHcccHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccc
MKITALLVLKCNPDGSDPVVLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRNGLCVMGFMDDHYPVRSSFSLLNQVLDEYQKNFGESWRTAQADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVE***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKITALLVLKCNPDGSDPVVLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRNGLCVMGFMDDHYPVRSSFSLLNQVLDEYQKNFGESWRTAQADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
VAMP-like protein YKT61 May be involved in the secretory pathway.confidentQ9ZRD6
Synaptobrevin homolog YKT6 Vesicular soluble NSF attachment protein receptor (v-SNARE) mediating vesicle docking and fusion to a specific acceptor cellular compartment. Functions in endoplasmic reticulum to Golgi transport; as part of a SNARE complex composed of GOSR1, GOSR2 and STX5. Functions in early/recycling endosome to TGN transport; as part of a SNARE complex composed of BET1L, GOSR1 and STX5. Has a S-palmitoyl transferase activity.probableQ9CQW1
VAMP-like protein YKT62 May be involved in the secretory pathway.probableQ9LVM9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KYQ, chain A
Confidence level:very confident
Coverage over the Query: 1-183
View the alignment between query and template
View the model in PyMOL