Citrus Sinensis ID: 029997

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----

MKITALLVLKCNPDGSDPVVLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRNGLCVMGFMDDHYPVRSSFSLLNQVLDEYQKNFGESWRTAQADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQT

cEEEEEEEEEcccccccccEEEEEECcccccHHHHHHHHHHHHHHHHHHHccccccccEEEECccEEEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHcccHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccc

MKITALLVLKCNPDGSDPVVLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRNGLCVMGFMDDHYPVRSSFSLLNQVLDEYQKNFGESWRTAQADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVE***********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKITALLVLKCNPDGSDPVVLATAMDVSHFGYFQRSSVKEFILFVARTVGKRTPPGQRQSVQHEEYKVHSYNRNGLCVMGFMDDHYPVRSSFSLLNQVLDEYQKNFGESWRTAQADNMQPWPYLNEALNKYQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
VAMP-like protein YKT61	May be involved in the secretory pathway.	confident	Q9ZRD6
Synaptobrevin homolog YKT6	Vesicular soluble NSF attachment protein receptor (v-SNARE) mediating vesicle docking and fusion to a specific acceptor cellular compartment. Functions in endoplasmic reticulum to Golgi transport; as part of a SNARE complex composed of GOSR1, GOSR2 and STX5. Functions in early/recycling endosome to TGN transport; as part of a SNARE complex composed of BET1L, GOSR1 and STX5. Has a S-palmitoyl transferase activity.	probable	Q9CQW1
VAMP-like protein YKT62	May be involved in the secretory pathway.	probable	Q9LVM9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KYQ, chain A
Confidence level:very confident
Coverage over the Query: 1-183
View the alignment between query and template
View the model in PyMOL