Citrus Sinensis ID: 030034


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MAARNHISRHPDSARGFRDGPRPVLTRGLAPMHFHPMTLEEEIEIQRREMHRIISENRHAIDDNTHLQRELTASKDEIHRLGQIIPKLRADKEAHTRELFDRGLKLEVELRASEPVRAEVVQLRAEVQKLNSSRQELTTQIKGLTKDVNRLEAENKQLIAMRADIDGIRSELVEARFEIRYFLG
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
*********************************F*******************************************IHRLGQIIPKLR*******RELFDRGLKLEVEL*********VV**************************V*RLEAENKQLIAMRADIDGIRSELVEARFEIRYFLG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAARNHISRHPDSARGFRDGPRPVLTRGLAPMHFHPMTLEEEIEIQRREMHRIISENRHAIDDNTHLQRELTASKDEIHRLGQIIPKLRADKEAHTRELFDRGLKLEVELRASEPVRAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRADIDGIRSELVEARFEIRYFLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 40-81
View the alignment between query and template
View the model in PyMOL
Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 40-138
View the alignment between query and template
View the model in PyMOL
Template: 3I00, chain A
Confidence level:probable
Coverage over the Query: 89-100,111-176
View the alignment between query and template
View the model in PyMOL