BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 030041
(184 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3R9S|A Chain A, Structure Of A Carnitinyl-Coa Dehydratase From
Mycobacterium Avium 104
pdb|3R9S|B Chain B, Structure Of A Carnitinyl-Coa Dehydratase From
Mycobacterium Avium 104
pdb|3R9S|C Chain C, Structure Of A Carnitinyl-Coa Dehydratase From
Mycobacterium Avium 104
Length = 267
Score = 29.6 bits (65), Expect = 0.94, Method: Compositional matrix adjust.
Identities = 12/38 (31%), Positives = 21/38 (55%)
Query: 60 LFLLASQVLIMLASRCFCCGKPLSPGGSRAWAVILFII 97
+F +A Q+ +A R G+PLS +R W +I ++
Sbjct: 150 VFRIAEQLPRKVAMRLLLTGEPLSAAAARDWGLINEVV 187
>pdb|3R9T|A Chain A, Structure Of Echa1_1 From Mycobacterium Paratuberculosis
Atcc Baa-968 K-10
pdb|3R9T|B Chain B, Structure Of Echa1_1 From Mycobacterium Paratuberculosis
Atcc Baa-968 K-10
pdb|3R9T|C Chain C, Structure Of Echa1_1 From Mycobacterium Paratuberculosis
Atcc Baa-968 K-10
Length = 267
Score = 29.6 bits (65), Expect = 0.99, Method: Compositional matrix adjust.
Identities = 12/38 (31%), Positives = 21/38 (55%)
Query: 60 LFLLASQVLIMLASRCFCCGKPLSPGGSRAWAVILFII 97
+F +A Q+ +A R G+PLS +R W +I ++
Sbjct: 150 VFRIAEQLPRKVAMRLLLTGEPLSAAAARDWGLINEVV 187
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.139 0.441
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,788,637
Number of Sequences: 62578
Number of extensions: 157414
Number of successful extensions: 353
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 340
Number of HSP's gapped (non-prelim): 14
length of query: 184
length of database: 14,973,337
effective HSP length: 93
effective length of query: 91
effective length of database: 9,153,583
effective search space: 832976053
effective search space used: 832976053
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 48 (23.1 bits)