Citrus Sinensis ID: 030089

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MDLNQPPGENYANPKTCFFHVLFKGAALAFYILSALFFDSFVIIFVVTVLLAALDFWVVKNVSGRILVGLRWWNEINDMGESVWKFECLDHESMARMNKKDSWLFWWTLYLSAVAWIVLGIFSLIRFQADYLLVVGVCLTLSIANIIGFTKCRKDAKKQIQQFASQTIASGFTSTLQSAFSVV
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEcccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcccc
*************PKTCFFHVLFKGAALAFYILSALFFDSFVIIFVVTVLLAALDFWVVKNVSGRILVGLRWWNEINDMGESVWKFECLDHESMARMNKKDSWLFWWTLYLSAVAWIVLGIFSLIRFQADYLLVVGVCLTLSIANIIGFTKCRKDAKKQIQQFAS*TIASGFTSTLQSAF***
xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLNQPPGENYANPKTCFFHVLFKGAALAFYILSALFFDSFVIIFVVTVLLAALDFWVVKNVSGRILVGLRWWNEINDMGESVWKFECLDHESMARMNKKDSWLFWWTLYLSAVAWIVLGIFSLIRFQADYLLVVGVCLTLSIANIIGFTKCRKDAKKQIQQFASQTIASGFTSTLQSAFSVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Golgi apparatus membrane protein-like protein ECHIDNA Mediates trans-Golgi-network trafficking and cell elongation. Required for keeping the appropriate balance between secretory trafficking and vacuolar targeting of a subset of proteins.confidentQ8LEK2
Golgi apparatus membrane protein TVP23 homolog B probableQ29S14
Uncharacterized Golgi apparatus membrane protein-like protein 1 probableQ86I95

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted