Citrus Sinensis ID: 030095


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MIKLFKVKEKQRENAENANGKTPVKKQSAGELRLHRDISELNLPKTCSITFPNGKDDLMNFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFIRCI
ccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccEEEcccccccEEEEEEEEcccccccccEEEEEEEcccccccccccEEEEccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHHHHHHccccccccccccc
ccEEEEEcccccHHHccccccccHccccHHHHHHHHHHHHHccccccccccccccccEEEEEEEEccccccccccEEEEEEEccccccccccEEEEccccccccEccccEEccHHHcccccccccHHHHHHHHHHHHHcccccccccHHHHHHccccHHHHHHHHHHHHHHHccccccccccc
MIKLFKVKEKQREnaenangktpvkkqsagelrlhrdiselnlpktcsitfpngkddlmnfevsirpdegyyvggtfvftfqvspiypheapkvkcktkvyhpnidlegnVCLNILredwkpvlniNTIIYGLFhlftqpnyedplnHEAAAvlrdnpklfeSNVRRamaggyvgQTFFIRCI
miklfkvkekqrenaenangktpvkkqsagelrlhrdiselnlpktcsitfpngkddLMNFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFIRCI
MIKLFKVKEKQRENAENANGKTPVKKQSAGELRLHRDISELNLPKTCSITFPNGKDDLMNFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFIRCI
*************************************ISELNLPKTCSITFPNGKDDLMNFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFIRC*
MIKLF*******************************DISELNLPKTCSITFPNGKDDLMNFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFIRCI
MIKLFKVKEK******************AGELRLHRDISELNLPKTCSITFPNGKDDLMNFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFIRCI
*IKLFKVKEK*******************GELRLHRDISELNLPKTCSITFPNGKDDLMNFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFF*RCI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKLFKVKEKQRENAENANGKTPVKKQSAGELRLHRDISELNLPKTCSITFPNGKDDLMNFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFIRCI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query183 2.2.26 [Sep-21-2011]
Q9SDY5184 NEDD8-conjugating enzyme yes no 1.0 0.994 0.869 1e-92
Q9ZU75185 Probable NEDD8-conjugatin no no 1.0 0.989 0.821 3e-88
Q6DCZ9183 NEDD8-conjugating enzyme N/A no 0.994 0.994 0.628 8e-65
Q6P8D9183 NEDD8-conjugating enzyme yes no 0.994 0.994 0.628 1e-64
P61082183 NEDD8-conjugating enzyme yes no 0.994 0.994 0.622 3e-64
P61081183 NEDD8-conjugating enzyme yes no 0.994 0.994 0.622 3e-64
A3KN22183 NEDD8-conjugating enzyme yes no 0.994 0.994 0.622 3e-64
Q9VSF3181 NEDD8-conjugating enzyme yes no 0.978 0.988 0.584 3e-58
Q6C9W0179 NEDD8-conjugating enzyme yes no 0.945 0.966 0.541 6e-52
O74549177 NEDD8-conjugating enzyme yes no 0.934 0.966 0.5 3e-46
>sp|Q9SDY5|RCE1_ARATH NEDD8-conjugating enzyme Ubc12 OS=Arabidopsis thaliana GN=RCE1 PE=1 SV=1 Back     alignment and function desciption
 Score =  338 bits (868), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 160/184 (86%), Positives = 171/184 (92%), Gaps = 1/184 (0%)

Query: 1   MIKLFKVKEKQRENAENAN-GKTPVKKQSAGELRLHRDISELNLPKTCSITFPNGKDDLM 59
           MI LFKVKEKQRE A+NA  G   VKKQSAGELRLH+DISELNLP +CSI+FPNGKDDLM
Sbjct: 1   MIGLFKVKEKQREQAQNATRGGASVKKQSAGELRLHKDISELNLPSSCSISFPNGKDDLM 60

Query: 60  NFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILRED 119
           NFEVSI+PD+GYY  GTFVFTFQVSP+YPHEAPKVKCKTKVYHPNIDLEGNVCLNILRED
Sbjct: 61  NFEVSIKPDDGYYHNGTFVFTFQVSPVYPHEAPKVKCKTKVYHPNIDLEGNVCLNILRED 120

Query: 120 WKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFF 179
           WKPVLNINT+IYGLFHLFT+PN EDPLNH+AAAVLRDNPKLFE+NVRRAM GGYVGQTFF
Sbjct: 121 WKPVLNINTVIYGLFHLFTEPNSEDPLNHDAAAVLRDNPKLFETNVRRAMTGGYVGQTFF 180

Query: 180 IRCI 183
            RCI
Sbjct: 181 PRCI 184




Accepts the ubiquitin-like protein NEDD8/RUB1 from the ECR1-AXR1 E1 complex and catalyzes its covalent attachment to other proteins.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9ZU75|UB12L_ARATH Probable NEDD8-conjugating enzyme Ubc12-like OS=Arabidopsis thaliana GN=RCE2 PE=2 SV=1 Back     alignment and function description
>sp|Q6DCZ9|UBC12_XENLA NEDD8-conjugating enzyme Ubc12 OS=Xenopus laevis GN=ube2m PE=2 SV=1 Back     alignment and function description
>sp|Q6P8D9|UBC12_XENTR NEDD8-conjugating enzyme Ubc12 OS=Xenopus tropicalis GN=ube2m PE=2 SV=1 Back     alignment and function description
>sp|P61082|UBC12_MOUSE NEDD8-conjugating enzyme Ubc12 OS=Mus musculus GN=Ube2m PE=2 SV=1 Back     alignment and function description
>sp|P61081|UBC12_HUMAN NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens GN=UBE2M PE=1 SV=1 Back     alignment and function description
>sp|A3KN22|UBC12_BOVIN NEDD8-conjugating enzyme Ubc12 OS=Bos taurus GN=UBE2M PE=2 SV=1 Back     alignment and function description
>sp|Q9VSF3|UBC12_DROME NEDD8-conjugating enzyme Ubc12 OS=Drosophila melanogaster GN=CG7375 PE=2 SV=1 Back     alignment and function description
>sp|Q6C9W0|UBC12_YARLI NEDD8-conjugating enzyme UBC12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBC12 PE=3 SV=1 Back     alignment and function description
>sp|O74549|UBC12_SCHPO NEDD8-conjugating enzyme ubc12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc12 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
359475268183 PREDICTED: NEDD8-conjugating enzyme Ubc1 1.0 1.0 0.928 5e-98
86156024183 ubiquitin-conjugating enzyme [Vitis pseu 1.0 1.0 0.923 6e-97
255568247183 ubiquitin-conjugating enzyme m, putative 1.0 1.0 0.901 8e-97
76573335183 RUB1-conjugating enzyme-like protein [So 1.0 1.0 0.896 1e-95
224094692183 predicted protein [Populus trichocarpa] 1.0 1.0 0.890 1e-95
388501480183 unknown [Lotus japonicus] gi|388505000|g 1.0 1.0 0.896 4e-95
363807446183 uncharacterized protein LOC100813186 [Gl 1.0 1.0 0.890 7e-95
115371812183 ubiquitin-conjugating enzyme [Capsicum a 1.0 1.0 0.879 1e-94
26000688183 RUB1 conjugating enzyme [Olea europaea] 1.0 1.0 0.885 5e-94
449448408183 PREDICTED: NEDD8-conjugating enzyme Ubc1 1.0 1.0 0.890 2e-93
>gi|359475268|ref|XP_003631628.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-like isoform 1 [Vitis vinifera] gi|359475270|ref|XP_003631629.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-like isoform 2 [Vitis vinifera] gi|147845872|emb|CAN82178.1| hypothetical protein VITISV_034608 [Vitis vinifera] gi|297741421|emb|CBI32552.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  362 bits (928), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 170/183 (92%), Positives = 179/183 (97%)

Query: 1   MIKLFKVKEKQRENAENANGKTPVKKQSAGELRLHRDISELNLPKTCSITFPNGKDDLMN 60
           MIKLFKVKEKQRE AENANGK PVKKQSAGELRLH+DISELNLPKTC I+FPNGKDDLM+
Sbjct: 1   MIKLFKVKEKQREIAENANGKAPVKKQSAGELRLHKDISELNLPKTCCISFPNGKDDLMS 60

Query: 61  FEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDW 120
           FEV+IRPDEGYY+GGTFVF+FQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDW
Sbjct: 61  FEVTIRPDEGYYLGGTFVFSFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDW 120

Query: 121 KPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFI 180
           KPVLNINTIIYGLFHLFTQPNYEDPLNH+AAAVLRDNPK+FESNVRRAMAGGYVGQTFF 
Sbjct: 121 KPVLNINTIIYGLFHLFTQPNYEDPLNHDAAAVLRDNPKMFESNVRRAMAGGYVGQTFFP 180

Query: 181 RCI 183
           RC+
Sbjct: 181 RCM 183




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|86156024|gb|ABC86743.1| ubiquitin-conjugating enzyme [Vitis pseudoreticulata] Back     alignment and taxonomy information
>gi|255568247|ref|XP_002525098.1| ubiquitin-conjugating enzyme m, putative [Ricinus communis] gi|223535557|gb|EEF37225.1| ubiquitin-conjugating enzyme m, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|76573335|gb|ABA46772.1| RUB1-conjugating enzyme-like protein [Solanum tuberosum] gi|82623385|gb|ABB87107.1| RUB1 conjugating enzyme-like [Solanum tuberosum] Back     alignment and taxonomy information
>gi|224094692|ref|XP_002310200.1| predicted protein [Populus trichocarpa] gi|118483300|gb|ABK93552.1| unknown [Populus trichocarpa] gi|222853103|gb|EEE90650.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388501480|gb|AFK38806.1| unknown [Lotus japonicus] gi|388505000|gb|AFK40566.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|363807446|ref|NP_001242389.1| uncharacterized protein LOC100813186 [Glycine max] gi|356538061|ref|XP_003537523.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-like [Glycine max] gi|255625655|gb|ACU13172.1| unknown [Glycine max] gi|255642299|gb|ACU21414.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|115371812|gb|ABI96209.1| ubiquitin-conjugating enzyme [Capsicum annuum] Back     alignment and taxonomy information
>gi|26000688|gb|AAN75193.1| RUB1 conjugating enzyme [Olea europaea] Back     alignment and taxonomy information
>gi|449448408|ref|XP_004141958.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-like [Cucumis sativus] gi|449497703|ref|XP_004160486.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
TAIR|locus:2115305184 RCE1 "RUB1 conjugating enzyme 1.0 0.994 0.869 2.6e-86
TAIR|locus:2046303185 AT2G18600 "AT2G18600" [Arabido 1.0 0.989 0.821 5.8e-82
UNIPROTKB|Q6DCZ9183 ube2m "NEDD8-conjugating enzym 0.989 0.989 0.641 5.5e-61
UNIPROTKB|Q6P8D9183 ube2m "NEDD8-conjugating enzym 0.989 0.989 0.641 5.5e-61
UNIPROTKB|A3KN22183 UBE2M "NEDD8-conjugating enzym 0.989 0.989 0.635 1.5e-60
UNIPROTKB|P61081183 UBE2M "NEDD8-conjugating enzym 0.989 0.989 0.635 1.5e-60
MGI|MGI:108278183 Ube2m "ubiquitin-conjugating e 0.989 0.989 0.635 1.5e-60
RGD|1307614183 Ube2m "ubiquitin-conjugating e 0.989 0.989 0.635 1.5e-60
UNIPROTKB|E2RIU5185 UBE2M "Uncharacterized protein 0.989 0.978 0.629 2.2e-59
FB|FBgn0035853181 Ubc12 "Ubiquitin conjugating e 0.978 0.988 0.584 1.1e-55
TAIR|locus:2115305 RCE1 "RUB1 conjugating enzyme 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 863 (308.9 bits), Expect = 2.6e-86, P = 2.6e-86
 Identities = 160/184 (86%), Positives = 171/184 (92%)

Query:     1 MIKLFKVKEKQRENAENAN-GKTPVKKQSAGELRLHRDISELNLPKTCSITFPNGKDDLM 59
             MI LFKVKEKQRE A+NA  G   VKKQSAGELRLH+DISELNLP +CSI+FPNGKDDLM
Sbjct:     1 MIGLFKVKEKQREQAQNATRGGASVKKQSAGELRLHKDISELNLPSSCSISFPNGKDDLM 60

Query:    60 NFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILRED 119
             NFEVSI+PD+GYY  GTFVFTFQVSP+YPHEAPKVKCKTKVYHPNIDLEGNVCLNILRED
Sbjct:    61 NFEVSIKPDDGYYHNGTFVFTFQVSPVYPHEAPKVKCKTKVYHPNIDLEGNVCLNILRED 120

Query:   120 WKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFF 179
             WKPVLNINT+IYGLFHLFT+PN EDPLNH+AAAVLRDNPKLFE+NVRRAM GGYVGQTFF
Sbjct:   121 WKPVLNINTVIYGLFHLFTEPNSEDPLNHDAAAVLRDNPKLFETNVRRAMTGGYVGQTFF 180

Query:   180 IRCI 183
              RCI
Sbjct:   181 PRCI 184




GO:0016881 "acid-amino acid ligase activity" evidence=IEA
GO:0019787 "small conjugating protein ligase activity" evidence=ISS;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009733 "response to auxin stimulus" evidence=IMP
GO:0009790 "embryo development" evidence=IGI
GO:0019788 "NEDD8 ligase activity" evidence=TAS
GO:0006301 "postreplication repair" evidence=RCA
TAIR|locus:2046303 AT2G18600 "AT2G18600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DCZ9 ube2m "NEDD8-conjugating enzyme Ubc12" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P8D9 ube2m "NEDD8-conjugating enzyme Ubc12" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|A3KN22 UBE2M "NEDD8-conjugating enzyme Ubc12" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P61081 UBE2M "NEDD8-conjugating enzyme Ubc12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:108278 Ube2m "ubiquitin-conjugating enzyme E2M" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307614 Ube2m "ubiquitin-conjugating enzyme E2M" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RIU5 UBE2M "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0035853 Ubc12 "Ubiquitin conjugating enzyme 12" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VSF3UBC12_DROME6, ., 3, ., 2, ., -0.58460.97810.9889yesno
Q9ZU75UB12L_ARATH6, ., 3, ., 2, ., -0.82161.00.9891nono
Q6DCZ9UBC12_XENLA6, ., 3, ., 2, ., -0.62840.99450.9945N/Ano
Q75AF2UBC12_ASHGO6, ., 3, ., 2, ., -0.42540.96170.9565yesno
Q9SDY5RCE1_ARATH6, ., 3, ., 2, ., -0.86951.00.9945yesno
P52491UBC12_YEAST6, ., 3, ., 2, ., -0.45810.93980.9148yesno
Q6FVQ8UBC12_CANGA6, ., 3, ., 2, ., -0.45970.90710.8877yesno
P61082UBC12_MOUSE6, ., 3, ., 2, ., -0.62290.99450.9945yesno
P61081UBC12_HUMAN6, ., 3, ., 2, ., -0.62290.99450.9945yesno
Q6P8D9UBC12_XENTR6, ., 3, ., 2, ., -0.62840.99450.9945yesno
O74549UBC12_SCHPO6, ., 3, ., 2, ., -0.50.93440.9661yesno
Q6CSW8UBC12_KLULA6, ., 3, ., 2, ., -0.40780.83060.8260yesno
Q6C9W0UBC12_YARLI6, ., 3, ., 2, ., -0.54180.94530.9664yesno
A3KN22UBC12_BOVIN6, ., 3, ., 2, ., -0.62290.99450.9945yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2.19LOW CONFIDENCE prediction!
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 1e-48
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 4e-45
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 4e-37
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 2e-32
PLN00172147 PLN00172, PLN00172, ubiquitin conjugating enzyme; 4e-24
PTZ00390152 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; 2e-18
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information
 Score =  154 bits (391), Expect = 1e-48
 Identities = 57/140 (40%), Positives = 80/140 (57%), Gaps = 4/140 (2%)

Query: 33  RLHRDISEL-NLPKTCSITFPNGKDDLMNFEVSIR-PDEGYYVGGTFVFTFQVSPIYPHE 90
           RL +++ EL   P      FP   D+L  +EV+I  P+   Y GG F    +    YP +
Sbjct: 1   RLQKELKELLKDPPPGISAFPV-DDNLFEWEVTIIGPEGTPYEGGVFKLDIEFPEDYPFK 59

Query: 91  APKVKCKTKVYHPNIDLEGNVCLNILR-EDWKPVLNINTIIYGLFHLFTQPNYEDPLNHE 149
            PKVK  TK+YHPN+D  G +CL+IL+ E+W P L I  ++  +  L ++PN EDPLN E
Sbjct: 60  PPKVKFTTKIYHPNVDPSGEICLDILKDENWSPALTIEQVLLSIQSLLSEPNPEDPLNAE 119

Query: 150 AAAVLRDNPKLFESNVRRAM 169
           AA + R N + FE  VR  +
Sbjct: 120 AAKLYRKNREEFEKKVREYV 139


Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. TSG101 is one of several UBC homologues that lacks this active site cysteine. Length = 139

>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 183
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 100.0
KOG0417148 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0419152 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 100.0
KOG0420184 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
PLN00172147 ubiquitin conjugating enzyme; Provisional 100.0
KOG0425171 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0424158 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0421175 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 100.0
KOG0426165 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 100.0
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 100.0
KOG0422153 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0416189 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0423223 consensus Ubiquitin-protein ligase [Posttranslatio 99.97
KOG0427161 consensus Ubiquitin conjugating enzyme [Posttransl 99.95
KOG0894244 consensus Ubiquitin-protein ligase [Posttranslatio 99.94
KOG0429258 consensus Ubiquitin-conjugating enzyme-related pro 99.9
KOG0428 314 consensus Non-canonical ubiquitin conjugating enzy 99.84
KOG08951101 consensus Ubiquitin-conjugating enzyme [Posttransl 99.56
KOG0896138 consensus Ubiquitin-conjugating enzyme E2 [Posttra 99.51
KOG0895 1101 consensus Ubiquitin-conjugating enzyme [Posttransl 99.49
KOG0897122 consensus Predicted ubiquitin-conjugating enzyme [ 98.59
PF14461133 Prok-E2_B: Prokaryotic E2 family B 98.52
PF05743121 UEV: UEV domain; InterPro: IPR008883 The N-termina 98.23
PF08694161 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 98.12
KOG2391 365 consensus Vacuolar sorting protein/ubiquitin recep 97.61
KOG3357167 consensus Uncharacterized conserved protein [Funct 97.32
smart00591107 RWD domain in RING finger and WD repeat containing 95.8
PF05773113 RWD: RWD domain; InterPro: IPR006575 The RWD eukar 95.19
PF14457162 Prok-E2_A: Prokaryotic E2 family A 94.51
PF14462122 Prok-E2_E: Prokaryotic E2 family E 92.95
PF09765291 WD-3: WD-repeat region; InterPro: IPR019162 This e 87.06
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 81.77
>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=3.9e-50  Score=303.22  Aligned_cols=146  Identities=36%  Similarity=0.682  Sum_probs=137.0

Q ss_pred             cHHHHHHHHHHHhc--CCCCCccEeecCCCCCcceEEEEE-eCCCCCCCCcEEEEEEEeCCCCCCCCCcceeeccceecc
Q 030095           28 SAGELRLHRDISEL--NLPKTCSITFPNGKDDLMNFEVSI-RPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPN  104 (183)
Q Consensus        28 ~~~~~RL~~El~~l--~~~~~~~~~~~~~~~n~~~w~~~i-gp~~tpyegg~f~~~i~fp~~YP~~pP~v~f~t~i~HPn  104 (183)
                      ..+.+||++|++++  .+++++++. |..++|+++|+++| ||.+||||||+|++.|.||++||++||+|+|.|+|||||
T Consensus         4 ~~a~~RL~kE~~~l~~~~~~~~~a~-p~~d~~l~~w~~~i~GP~dtpYegg~f~~~l~fP~~YP~~PPkv~F~t~i~HPN   82 (153)
T COG5078           4 PSALKRLLKELKKLQKDPPPGISAG-PVDDDNLFHWEATITGPPDTPYEGGIFKLTLEFPEDYPFKPPKVRFTTKIFHPN   82 (153)
T ss_pred             hhHHHHHHHHHHHHhcCCCCceEEE-ECCCCcceeEEEEEECCCCCCcCCCEEEEEEECCCCCCCCCCeeeeccCCcCCC
Confidence            34999999999999  345677774 66455999999999 999999999999999999999999999999999999999


Q ss_pred             ccCCCcEeccccCCccCCCCCHHHHHHHHHHhhcCCCCCCcccHHHHHHHhhCHHHHHHHHHHHHhcCCC
Q 030095          105 IDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYV  174 (183)
Q Consensus       105 V~~~G~icl~~l~~~W~p~~~i~~il~~i~~ll~~p~~~~~~n~~aa~~~~~~~~~f~~~~~~~~~~~~~  174 (183)
                      |+.+|+||+++|++.|+|++++++||.+|+++|.+||+++|+|.|||++|++|+++|.++||++++++..
T Consensus        83 V~~~G~vCLdIL~~~WsP~~~l~sILlsl~slL~~PN~~~Pln~daa~~~~~d~~~y~~~vr~~~~~~~~  152 (153)
T COG5078          83 VDPSGNVCLDILKDRWSPVYTLETILLSLQSLLLSPNPDSPLNTEAATLYREDKEEYEKKVREWVKKYAE  152 (153)
T ss_pred             cCCCCCChhHHHhCCCCccccHHHHHHHHHHHHcCCCCCCCCChHHHHHHHhCHHHHHHHHHHHHHHhcc
Confidence            9999999999999999999999999999999999999999999999999999999999999999998864



>KOG0417 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0419 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>KOG0420 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>KOG0425 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0424 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0421 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>KOG0426 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0422 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0416 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0423 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0427 consensus Ubiquitin conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0894 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0429 consensus Ubiquitin-conjugating enzyme-related protein Ft1, involved in programmed cell death [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0428 consensus Non-canonical ubiquitin conjugating enzyme 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0896 consensus Ubiquitin-conjugating enzyme E2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0897 consensus Predicted ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14461 Prok-E2_B: Prokaryotic E2 family B Back     alignment and domain information
>PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) Back     alignment and domain information
>PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3357 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information
>PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) Back     alignment and domain information
>PF14457 Prok-E2_A: Prokaryotic E2 family A Back     alignment and domain information
>PF14462 Prok-E2_E: Prokaryotic E2 family E Back     alignment and domain information
>PF09765 WD-3: WD-repeat region; InterPro: IPR019162 This entry represents a region of approximately 100 residues containing three WD repeats and six cysteine residues- possibly as three cysteine-bridges associated with FancL Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
2nvu_C180 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 7e-63
1y8x_A160 Structural Basis For Recruitment Of Ubc12 By An E2- 2e-58
3o2u_A190 S. Cerevisiae Ubc12 Length = 190 1e-39
3fn1_B167 E2-Ring Expansion Of The Nedd8 Cascade Confers Spec 7e-24
2edi_A173 Solution Structure Of The Uq_con Domain From Human 3e-23
4gpr_A151 Crystal Structure Of Ehubc5, A Ubiquitin Conjugatin 3e-22
4ii2_C163 Crystal Structure Of Ubiquitin Activating Enzyme 1 1e-20
1qcq_A148 Ubiquitin Conjugating Enzyme Length = 148 7e-20
2c4o_B165 Crystal Structure Of Human Ubiquitin-Conjugating En 2e-19
2c4p_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 3e-19
3tgd_A152 Crystal Structure Of The Human Ubiquitin-Conjugatin 4e-19
2esk_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil 4e-19
3eb6_B149 Structure Of The Ciap2 Ring Domain Bound To Ubch5b 4e-19
1ur6_A147 Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp 5e-19
3l1y_A157 Crystal Structure Of Human Ubc4 E2 Conjugating Enzy 6e-19
2yho_B149 The Idol-Ube2d Complex Mediates Sterol-Dependent De 6e-19
2esq_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 6e-19
3oj4_A153 Crystal Structure Of The A20 Znf4, Ubiquitin And Ub 7e-19
2ayv_A166 Crystal Structure Of A Putative Ubiquitin-Conjugati 8e-19
3l1z_A157 Crystal Structure Of The U-Box Domain Of Human E4b 1e-18
1x23_A155 Crystal Structure Of Ubch5c Length = 155 1e-18
3rpg_A149 Bmi1RING1B-Ubch5c Complex Structure Length = 149 1e-18
2fuh_A146 Solution Structure Of The Ubch5cUB NON-Covalent Com 1e-18
2eso_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 1e-18
1z2u_A150 The 1.1a Crystallographic Structure Of Ubiquitin- C 1e-18
2esp_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 2e-18
2oxq_A152 Structure Of The Ubch5 :chip U-Box Complex Length = 3e-18
2c4o_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 3e-18
4ddg_A 399 Crystal Structure Of Human Otub1UBCH5B~UBUB Length 4e-18
3a33_A150 Ubch5b~ubiquitin Conjugate Length = 150 6e-18
3jvz_A146 E2~ubiquitin-Hect Length = 146 7e-18
1jat_A155 Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Leng 1e-17
1jbb_A153 Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 1e-17
3ugb_A147 Ubch5c~ubiquitin Conjugate Length = 147 2e-17
2aak_A152 Ubiquitin Conjugating Enzyme From Arabidopsis Thali 2e-17
4ap4_B153 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 6e-17
4epo_B155 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 8e-17
2c2v_B154 Crystal Structure Of The Chip-Ubc13-Uev1a Complex L 8e-17
3hct_B155 Crystal Structure Of Traf6 In Complex With Ubc13 In 8e-17
1j7d_B152 Crystal Structure Of Hmms2-Hubc13 Length = 152 8e-17
1q34_A163 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 8e-17
3von_C148 Crystalstructure Of The Ubiquitin Protease Length = 8e-17
1z3d_A157 Protein Crystal Growth Improvement Leading To The 2 1e-16
4auq_A147 Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 1e-16
2gmi_A152 Mms2UBC13~UBIQUITIN Length = 152 1e-16
2grp_A161 Crystal Structure Of Human Rangap1-Ubc9-Y87a Length 3e-16
2o25_C160 Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed Wi 5e-16
1kps_A159 Structural Basis For E2-Mediated Sumo Conjugation R 5e-16
3a4s_A163 The Crystal Structure Of The Sld2:ubc9 Complex Leng 5e-16
1z5s_A158 Crystal Structure Of A Complex Between Ubc9, Sumo-1 5e-16
1u9a_A160 Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 16 5e-16
2grn_A161 Crystal Structure Of Human Rangap1-Ubc9 Length = 16 6e-16
1jas_A152 Hsubc2b Length = 152 6e-16
1y6l_A149 Human Ubiquitin Conjugating Enzyme E2e2 Length = 14 6e-16
3e95_A151 Crystal Structure Of The Plasmodium Falciparum Ubiq 8e-16
4fh1_A153 S. Cerevisiae Ubc13-N79a Length = 153 8e-16
2r0j_A149 Crystal Structure Of The Putative Ubiquitin Conjuga 8e-16
2e2c_A156 E2-C, An Ubiquitin Conjugating Enzyme Required For 1e-15
1pzv_A164 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 2e-15
3bzh_A194 Crystal Structure Of Human Ubiquitin-Conjugating En 2e-15
2gro_A161 Crystal Structure Of Human Rangap1-Ubc9-N85q Length 2e-15
2grr_A161 Crystal Structure Of Human Rangap1-Ubc9-D127s Lengt 3e-15
2grq_A161 Crystal Structure Of Human Rangap1-Ubc9-D127a Lengt 4e-15
1i7k_A179 Crystal Structure Of Human Mitotic-Specific Ubiquit 5e-15
3uio_A158 Complex Between Human Rangap1-Sumo2, Ubc9 And The I 7e-15
2uyz_A158 Non-Covalent Complex Between Ubc9 And Sumo1 Length 8e-15
1zdn_A158 Ubiquitin-Conjugating Enzyme E2s Length = 158 9e-15
2pwq_A216 Crystal Structure Of A Putative Ubiquitin Conjugati 2e-14
1ayz_A169 Crystal Structure Of The Saccharomyces Cerevisiae U 5e-14
2f4z_A193 Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtw 5e-14
1yh2_A169 Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 6e-14
1wzv_A155 Crystal Structure Of Ubch8 Length = 155 7e-14
2kjh_A152 Nmr Based Structural Model Of The Ubch8-Ubiquitin C 7e-14
1c4z_D154 Structure Of E6ap: Insights Into Ubiquitination Pat 8e-14
3sqv_C156 Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin L 8e-14
3rcz_B163 Rad60 Sld2 Ubc9 Complex Length = 163 3e-13
1tte_A215 The Structure Of A Class Ii Ubiquitin-Conjugating E 4e-13
2awf_A172 Structure Of Human Ubiquitin-Conjugating Enzyme E2 4e-13
3ong_B159 Crystal Structure Of Uba2ufd-ubc9: Insights Into E1 5e-13
2gjd_A157 Distinct Functional Domains Of Ubc9 Dictate Cell Su 6e-13
1fxt_A149 Structure Of A Conjugating Enzyme-Ubiquitin Thioles 1e-12
3rz3_A183 Human Cdc34 E2 In Complex With Cc0651 Inhibitor Len 3e-12
2ob4_A180 Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 1 4e-12
1yf9_A171 Structural Analysis Of Leishmania Major Ubiquitin C 1e-11
2onu_A152 Plasmodium Falciparum Ubiquitin Conjugating Enzyme 5e-11
3k9p_A217 The Crystal Structure Of E2-25k And Ubiquitin Compl 1e-10
3e46_A253 Crystal Structure Of Ubiquitin-Conjugating Enzyme E 1e-10
2bep_A159 Crystal Structure Of Ubiquitin Conjugating Enzyme E 1e-10
1yla_A202 Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington 1e-10
3k9o_A201 The Crystal Structure Of E2-25k And Ubb+1 Complex L 1e-10
2z5d_A179 Human Ubiquitin-Conjugating Enzyme E2 H Length = 17 4e-10
1yrv_A169 Novel Ubiquitin-Conjugating Enzyme Length = 169 8e-10
2ucz_A165 Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomy 1e-09
3h8k_A164 Crystal Structure Of Ube2g2 Complxed With The G2br 5e-09
2cyx_A170 Structure Of Human Ubiquitin-Conjugating Enzyme E2 5e-09
3fsh_A168 Crystal Structure Of The Ubiquitin Conjugating Enzy 5e-09
2kly_A167 Solution Structure Of Human Ubiquitin Conjugating E 6e-09
4ds2_A167 Ubiquitin Conjugating Enzyme (Putative) From Trypan 9e-08
2y9p_A172 Pex4p-Pex22p Mutant Ii Structure Length = 172 2e-07
2y9o_A172 Pex4p-Pex22p Mutant I Structure Length = 172 5e-07
2y9m_A172 Pex4p-Pex22p Structure Length = 172 9e-07
2a7l_A136 Structure Of The Human Hypothetical Ubiquitin-Conju 1e-06
>pdb|2NVU|C Chain C, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 180 Back     alignment and structure

Iteration: 1

Score = 236 bits (601), Expect = 7e-63, Method: Compositional matrix adjust. Identities = 112/183 (61%), Positives = 145/183 (79%), Gaps = 6/183 (3%) Query: 1 MIKLFKVKEKQRENAENANGKTPVKKQSAGELRLHRDISELNLPKTCSITFPNGKDDLMN 60 MIKLF +K++++E + ++ KK SA +LR+ +DI+ELNLPKTC I+F + DDL+N Sbjct: 3 MIKLFSLKQQKKEEEKGSS-----KKASAAQLRIQKDINELNLPKTCDISFSD-PDDLLN 56 Query: 61 FEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDW 120 F++ I PDEG+Y G FVF+F+V YPH+ PKVKC+T VYHPNIDLEGNV LNILREDW Sbjct: 57 FKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVALNILREDW 116 Query: 121 KPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFI 180 KPVL IN+IIYGL +LF +PN EDPLN EAA VL++N +LFE NV+R+M GGY+G T+F Sbjct: 117 KPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFE 176 Query: 181 RCI 183 RC+ Sbjct: 177 RCL 179
>pdb|1Y8X|A Chain A, Structural Basis For Recruitment Of Ubc12 By An E2-Binding Domain In Nedd8's E1 Length = 160 Back     alignment and structure
>pdb|3O2U|A Chain A, S. Cerevisiae Ubc12 Length = 190 Back     alignment and structure
>pdb|3FN1|B Chain B, E2-Ring Expansion Of The Nedd8 Cascade Confers Specificity To Cullin Modification Length = 167 Back     alignment and structure
>pdb|2EDI|A Chain A, Solution Structure Of The Uq_con Domain From Human Nedd8- Conjugating Enzyme Nce2 Length = 173 Back     alignment and structure
>pdb|4GPR|A Chain A, Crystal Structure Of Ehubc5, A Ubiquitin Conjugating Enzyme From Entamoeba Histolytica Length = 151 Back     alignment and structure
>pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 Back     alignment and structure
>pdb|1QCQ|A Chain A, Ubiquitin Conjugating Enzyme Length = 148 Back     alignment and structure
>pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 Back     alignment and structure
>pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 Back     alignment and structure
>pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 Back     alignment and structure
>pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 Back     alignment and structure
>pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 Back     alignment and structure
>pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 Back     alignment and structure
>pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 Back     alignment and structure
>pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 Back     alignment and structure
>pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 Back     alignment and structure
>pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 Back     alignment and structure
>pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 Back     alignment and structure
>pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 Back     alignment and structure
>pdb|2ESO|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile37ala Length = 149 Back     alignment and structure
>pdb|1Z2U|A Chain A, The 1.1a Crystallographic Structure Of Ubiquitin- Conjugating Enzyme (Ubc-2) From Caenorhabditis Elegans: Functional And Evolutionary Significance Length = 150 Back     alignment and structure
>pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 Back     alignment and structure
>pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 Back     alignment and structure
>pdb|2C4O|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|4DDG|A Chain A, Crystal Structure Of Human Otub1UBCH5B~UBUB Length = 399 Back     alignment and structure
>pdb|3A33|A Chain A, Ubch5b~ubiquitin Conjugate Length = 150 Back     alignment and structure
>pdb|3JVZ|A Chain A, E2~ubiquitin-Hect Length = 146 Back     alignment and structure
>pdb|1JAT|A Chain A, Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Length = 155 Back     alignment and structure
>pdb|1JBB|A Chain A, Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 Back     alignment and structure
>pdb|3UGB|A Chain A, Ubch5c~ubiquitin Conjugate Length = 147 Back     alignment and structure
>pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 Back     alignment and structure
>pdb|4AP4|B Chain B, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 153 Back     alignment and structure
>pdb|4EPO|B Chain B, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 155 Back     alignment and structure
>pdb|2C2V|B Chain B, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 154 Back     alignment and structure
>pdb|3HCT|B Chain B, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 155 Back     alignment and structure
>pdb|1J7D|B Chain B, Crystal Structure Of Hmms2-Hubc13 Length = 152 Back     alignment and structure
>pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 Back     alignment and structure
>pdb|3VON|C Chain C, Crystalstructure Of The Ubiquitin Protease Length = 148 Back     alignment and structure
>pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 Back     alignment and structure
>pdb|4AUQ|A Chain A, Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 Back     alignment and structure
>pdb|2GMI|A Chain A, Mms2UBC13~UBIQUITIN Length = 152 Back     alignment and structure
>pdb|2GRP|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-Y87a Length = 161 Back     alignment and structure
>pdb|2O25|C Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With Sumo-1- Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|1KPS|A Chain A, Structural Basis For E2-Mediated Sumo Conjugation Revealed By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 And Rangap1 Length = 159 Back     alignment and structure
>pdb|3A4S|A Chain A, The Crystal Structure Of The Sld2:ubc9 Complex Length = 163 Back     alignment and structure
>pdb|1Z5S|A Chain A, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 158 Back     alignment and structure
>pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|2GRN|A Chain A, Crystal Structure Of Human Rangap1-Ubc9 Length = 161 Back     alignment and structure
>pdb|1JAS|A Chain A, Hsubc2b Length = 152 Back     alignment and structure
>pdb|1Y6L|A Chain A, Human Ubiquitin Conjugating Enzyme E2e2 Length = 149 Back     alignment and structure
>pdb|3E95|A Chain A, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 151 Back     alignment and structure
>pdb|4FH1|A Chain A, S. Cerevisiae Ubc13-N79a Length = 153 Back     alignment and structure
>pdb|2R0J|A Chain A, Crystal Structure Of The Putative Ubiquitin Conjugating Enzyme, Pfe1350c, From Plasmodium Falciparum Length = 149 Back     alignment and structure
>pdb|2E2C|A Chain A, E2-C, An Ubiquitin Conjugating Enzyme Required For The Destruction Of Mitotic Cyclins Length = 156 Back     alignment and structure
>pdb|1PZV|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 164 Back     alignment and structure
>pdb|3BZH|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme E2 E1 Length = 194 Back     alignment and structure
>pdb|2GRO|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-N85q Length = 161 Back     alignment and structure
>pdb|2GRR|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127s Length = 161 Back     alignment and structure
>pdb|2GRQ|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127a Length = 161 Back     alignment and structure
>pdb|1I7K|A Chain A, Crystal Structure Of Human Mitotic-Specific Ubiquitin- Conjugating Enzyme, Ubch10 Length = 179 Back     alignment and structure
>pdb|3UIO|A Chain A, Complex Between Human Rangap1-Sumo2, Ubc9 And The Ir1 Domain From Ranbp2 Containing Ir2 Motif Ii Length = 158 Back     alignment and structure
>pdb|2UYZ|A Chain A, Non-Covalent Complex Between Ubc9 And Sumo1 Length = 158 Back     alignment and structure
>pdb|1ZDN|A Chain A, Ubiquitin-Conjugating Enzyme E2s Length = 158 Back     alignment and structure
>pdb|2PWQ|A Chain A, Crystal Structure Of A Putative Ubiquitin Conjugating Enzyme From Plasmodium Yoelii Length = 216 Back     alignment and structure
>pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Ubiquitin- Conjugating Enzyme Rad6 (Ubc2) At 2.6a Resolution Length = 169 Back     alignment and structure
>pdb|2F4Z|A Chain A, Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtwinscan_2721- E2 Domain Length = 193 Back     alignment and structure
>pdb|1YH2|A Chain A, Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 Back     alignment and structure
>pdb|1WZV|A Chain A, Crystal Structure Of Ubch8 Length = 155 Back     alignment and structure
>pdb|2KJH|A Chain A, Nmr Based Structural Model Of The Ubch8-Ubiquitin Complex Length = 152 Back     alignment and structure
>pdb|1C4Z|D Chain D, Structure Of E6ap: Insights Into Ubiquitination Pathway Length = 154 Back     alignment and structure
>pdb|3SQV|C Chain C, Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin Ligase, Nlel, With A Human E2, Ubch7 Length = 156 Back     alignment and structure
>pdb|3RCZ|B Chain B, Rad60 Sld2 Ubc9 Complex Length = 163 Back     alignment and structure
>pdb|1TTE|A Chain A, The Structure Of A Class Ii Ubiquitin-Conjugating Enzyme, Ubc1 Length = 215 Back     alignment and structure
>pdb|2AWF|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G1 Length = 172 Back     alignment and structure
>pdb|3ONG|B Chain B, Crystal Structure Of Uba2ufd-ubc9: Insights Into E1-e2 Interactions In Sumo Pathways Length = 159 Back     alignment and structure
>pdb|2GJD|A Chain A, Distinct Functional Domains Of Ubc9 Dictate Cell Survival And Resistance To Genotoxic Stress Length = 157 Back     alignment and structure
>pdb|1FXT|A Chain A, Structure Of A Conjugating Enzyme-Ubiquitin Thiolester Complex Length = 149 Back     alignment and structure
>pdb|3RZ3|A Chain A, Human Cdc34 E2 In Complex With Cc0651 Inhibitor Length = 183 Back     alignment and structure
>pdb|2OB4|A Chain A, Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 180 Back     alignment and structure
>pdb|1YF9|A Chain A, Structural Analysis Of Leishmania Major Ubiquitin Conjugating Enzyme E2 Length = 171 Back     alignment and structure
>pdb|2ONU|A Chain A, Plasmodium Falciparum Ubiquitin Conjugating Enzyme Pf10_0330, Putative Homologue Of Human Ube2h Length = 152 Back     alignment and structure
>pdb|3K9P|A Chain A, The Crystal Structure Of E2-25k And Ubiquitin Complex Length = 217 Back     alignment and structure
>pdb|3E46|A Chain A, Crystal Structure Of Ubiquitin-Conjugating Enzyme E2-25kda (Huntington Interacting Protein 2) M172a Mutant Length = 253 Back     alignment and structure
>pdb|2BEP|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2-25k Length = 159 Back     alignment and structure
>pdb|1YLA|A Chain A, Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington Interacting Protein 2) Length = 202 Back     alignment and structure
>pdb|3K9O|A Chain A, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 201 Back     alignment and structure
>pdb|2Z5D|A Chain A, Human Ubiquitin-Conjugating Enzyme E2 H Length = 179 Back     alignment and structure
>pdb|1YRV|A Chain A, Novel Ubiquitin-Conjugating Enzyme Length = 169 Back     alignment and structure
>pdb|2UCZ|A Chain A, Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomyces Cerevisiae Length = 165 Back     alignment and structure
>pdb|3H8K|A Chain A, Crystal Structure Of Ube2g2 Complxed With The G2br Domain Of Gp78 At 1.8-A Resolution Length = 164 Back     alignment and structure
>pdb|2CYX|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G2 (Ube2g2UBC7) Length = 170 Back     alignment and structure
>pdb|3FSH|A Chain A, Crystal Structure Of The Ubiquitin Conjugating Enzyme Ube2g2 Bound To The G2br Domain Of Ubiquitin Ligase Gp78 Length = 168 Back     alignment and structure
>pdb|2KLY|A Chain A, Solution Structure Of Human Ubiquitin Conjugating Enzyme Ube2g2 Length = 167 Back     alignment and structure
>pdb|4DS2|A Chain A, Ubiquitin Conjugating Enzyme (Putative) From Trypanosoma Cruzi Length = 167 Back     alignment and structure
>pdb|2Y9P|A Chain A, Pex4p-Pex22p Mutant Ii Structure Length = 172 Back     alignment and structure
>pdb|2Y9O|A Chain A, Pex4p-Pex22p Mutant I Structure Length = 172 Back     alignment and structure
>pdb|2Y9M|A Chain A, Pex4p-Pex22p Structure Length = 172 Back     alignment and structure
>pdb|2A7L|A Chain A, Structure Of The Human Hypothetical Ubiquitin-Conjugating Enzyme, Loc55284 Length = 136 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 5e-84
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 4e-80
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 1e-78
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 1e-59
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 1e-57
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 3e-48
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 2e-41
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 2e-39
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 1e-38
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 1e-38
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 2e-38
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 2e-38
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 2e-38
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 3e-38
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 4e-38
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 5e-38
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 5e-38
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 7e-38
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 9e-38
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 1e-37
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 2e-37
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 2e-37
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 3e-37
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 8e-37
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 2e-36
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 2e-36
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 3e-36
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 6e-36
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 6e-36
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 9e-36
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 9e-36
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 1e-35
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 1e-35
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 3e-35
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 4e-34
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 1e-33
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 3e-33
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 4e-33
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 1e-32
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 1e-31
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 2e-29
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 4e-28
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 1e-27
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 1e-26
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 1e-25
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 2e-24
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 3e-24
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 7e-22
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 6e-20
3ceg_A323 Baculoviral IAP repeat-containing protein 6; apopt 4e-18
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 6e-05
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure
 Score =  244 bits (626), Expect = 5e-84
 Identities = 112/183 (61%), Positives = 145/183 (79%), Gaps = 6/183 (3%)

Query: 1   MIKLFKVKEKQRENAENANGKTPVKKQSAGELRLHRDISELNLPKTCSITFPNGKDDLMN 60
           MIKLF +K++++E  + ++     KK SA +LR+ +DI+ELNLPKTC I+F +  DDL+N
Sbjct: 3   MIKLFSLKQQKKEEEKGSS-----KKASAAQLRIQKDINELNLPKTCDISFSDP-DDLLN 56

Query: 61  FEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDW 120
           F++ I PDEG+Y  G FVF+F+V   YPH+ PKVKC+T VYHPNIDLEGNV LNILREDW
Sbjct: 57  FKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVALNILREDW 116

Query: 121 KPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFI 180
           KPVL IN+IIYGL +LF +PN EDPLN EAA VL++N +LFE NV+R+M GGY+G T+F 
Sbjct: 117 KPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFE 176

Query: 181 RCI 183
           RC+
Sbjct: 177 RCL 179


>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Length = 146 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 100.0
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 100.0
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 100.0
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 100.0
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 100.0
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 100.0
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 100.0
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 100.0
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 100.0
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 100.0
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 100.0
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 100.0
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 100.0
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 100.0
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 100.0
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 100.0
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 100.0
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 100.0
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 100.0
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 100.0
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 100.0
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 100.0
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 100.0
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 100.0
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 100.0
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 100.0
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 100.0
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 100.0
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 100.0
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 100.0
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 100.0
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 100.0
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 100.0
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 100.0
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 100.0
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 100.0
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 100.0
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 100.0
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 100.0
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 100.0
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 100.0
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 100.0
3ceg_A323 Baculoviral IAP repeat-containing protein 6; apopt 100.0
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 100.0
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 100.0
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 100.0
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 100.0
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 100.0
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 100.0
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 100.0
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 100.0
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.91
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 99.77
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 99.69
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 99.49
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 96.6
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 95.53
1ukx_A137 GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple 94.93
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 94.82
1tt5_E26 Ubiquitin-conjugating enzyme E2 M; cell cycle, lig 94.76
3zqs_A186 E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A 94.51
2ebk_A128 RWD domain-containing protein 3; alpha+beta sandwi 93.35
2daw_A154 RWD domain containing protein 2; alpha+beta sandwi 92.32
2dax_A152 Protein C21ORF6; RWD domain, alpha+beta sandwich f 89.86
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
Probab=100.00  E-value=3.1e-52  Score=326.92  Aligned_cols=180  Identities=44%  Similarity=0.817  Sum_probs=169.2

Q ss_pred             CcchhhhHHHHHHHHhhhcCCCCCCCCcHHHHHHHHHHHhcCCCCCccEee---cCCCCCcc---eEEEEEeCCCCCCCC
Q 030095            1 MIKLFKVKEKQRENAENANGKTPVKKQSAGELRLHRDISELNLPKTCSITF---PNGKDDLM---NFEVSIRPDEGYYVG   74 (183)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RL~~El~~l~~~~~~~~~~---~~~~~n~~---~w~~~igp~~tpyeg   74 (183)
                      ||+++.+|++++++++..+  ++....+.+.+||++||++++.++++.+.+   +. .+|++   +|+++|+|++|||+|
T Consensus         3 m~~l~~~~~~~~~~~~~~~--~~~~~~s~a~~RL~kEl~~l~~~~~i~~~~~~~p~-~~nl~~~~~w~~~I~p~~tpyeg   79 (190)
T 3o2u_A            3 MLKLRQLQKKKQKENENSS--SIQPNLSAARIRLKRDLDSLDLPPTVTLNVITSPD-SADRSQSPKLEVIVRPDEGYYNY   79 (190)
T ss_dssp             HHHHHHHHHHHHHHHHHHH--SSSCCCCHHHHHHHHHHHTCCCCTTEEEEEEECTT-CCCTTSCCEEEEEECCSSSTTTT
T ss_pred             hHHHHHHHHHHHHHHHhcC--CCCCCccHHHHHHHHHHHhccCCCCEEEEecCCCC-CccCCcCCeEEEEEcCCCCCCCC
Confidence            7999999999998877543  667778899999999999998777888764   65 78999   999999888899999


Q ss_pred             cEEEEEEEeCCCCCCCCCcceeeccceeccccCCCcEeccccCCccCCCCCHHHHHHHHHHhhcCCCCCCcccHHHHHHH
Q 030095           75 GTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVL  154 (183)
Q Consensus        75 g~f~~~i~fp~~YP~~pP~v~f~t~i~HPnV~~~G~icl~~l~~~W~p~~~i~~il~~i~~ll~~p~~~~~~n~~aa~~~  154 (183)
                      |.|+++|.||++||++||+|+|.|+||||||+.+|.||+++|.++|+|++++.+||.+|+++|.+|++++|+|.+||++|
T Consensus        80 g~f~~~i~fp~~YP~~PP~v~f~t~i~HPnV~~~G~iCl~iL~~~W~p~~~i~~vL~~i~~ll~~pn~~~pln~~aa~~~  159 (190)
T 3o2u_A           80 GSINFNLDFNEVYPIEPPKVVCLKKIFHPNIDLKGNVCLNILREDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLL  159 (190)
T ss_dssp             CCEEEEEECCTTTTTSCCEEEECSCCCCTTBCTTSBBCCGGGTTTCCTTCCHHHHHHHHHHHHHSCCTTSCSSHHHHHHH
T ss_pred             CEEEEEEECCCCCCCCCceeEEecCcccCCCCCCCeEechhccCCCCCCCCHHHHHHHHHHHHhCCCCCcchhHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhCHHHHHHHHHHHHhcCCCCccccccCC
Q 030095          155 RDNPKLFESNVRRAMAGGYVGQTFFIRCI  183 (183)
Q Consensus       155 ~~~~~~f~~~~~~~~~~~~~~~~~~~~~~  183 (183)
                      .+|+++|+++||+|++++++.++.|++|+
T Consensus       160 ~~d~~~f~~~ar~~~~~~~~~~~~~~~~~  188 (190)
T 3o2u_A          160 CEGEKEFAEAVRLTMSGGSIEHVKYDNIV  188 (190)
T ss_dssp             HTCHHHHHHHHHHHHBTCEETTEECCBCC
T ss_pred             HHCHHHHHHHHHHHHHhcCCCCccccccc
Confidence            99999999999999999999999999986



>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Back     alignment and structure
>1tt5_E Ubiquitin-conjugating enzyme E2 M; cell cycle, ligase; 2.60A {Homo sapiens} Back     alignment and structure
>3zqs_A E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A {Homo sapiens} Back     alignment and structure
>2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 183
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 5e-50
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 2e-34
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 2e-33
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 5e-32
d1z3da1149 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U 7e-32
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 3e-31
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 3e-30
d2ucza_164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 4e-30
d1wzva1150 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U 3e-29
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 7e-29
d1c4zd_144 d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H 1e-28
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 5e-28
d1i7ka_146 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 3e-27
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 8e-27
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 8e-27
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 1e-26
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 2e-26
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 2e-26
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 6e-26
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 2e-25
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 2e-25
d1yf9a1158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 3e-24
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 3e-23
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 7e-23
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 2e-19
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 3e-19
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 2e-17
d1uzxa_152 d.20.1.2 (A:) Vacuolar protein sorting-associated 9e-16
d2f4wa1157 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, 2e-14
d1s1qa_141 d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 9e-14
d1zuoa1162 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme 8e-12
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), E2 M [TaxId: 9606]
 Score =  156 bits (396), Expect = 5e-50
 Identities = 104/156 (66%), Positives = 129/156 (82%), Gaps = 1/156 (0%)

Query: 28  SAGELRLHRDISELNLPKTCSITFPNGKDDLMNFEVSIRPDEGYYVGGTFVFTFQVSPIY 87
           SA +LR+ +DI+ELNLPKTC I+F +  DDL+NF++ I PDEG+Y  G FVF+F+V   Y
Sbjct: 2   SAAQLRIQKDINELNLPKTCDISFSD-PDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGY 60

Query: 88  PHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLN 147
           PH+ PKVKC+T VYHPNIDLEGNVCLNILREDWKPVL IN+IIYGL +LF +PN EDPLN
Sbjct: 61  PHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLN 120

Query: 148 HEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFIRCI 183
            EAA VL++N +LFE NV+R+M GGY+G T+F RC+
Sbjct: 121 KEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCL 156


>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 100.0
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 100.0
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 100.0
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 100.0
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 100.0
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 100.0
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 100.0
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 100.0
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 100.0
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 100.0
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 100.0
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 99.79
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 99.73
d2in1a1162 Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie 98.0
d2daya1115 E3 ubiquitin-protein ligase RNF25 {Human (Homo sap 95.35
d1ukxa_137 EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu 94.21
d2daxa1140 Uncharacterized protein C21orf6 {Human (Homo sapie 93.69
d2dawa1141 RWD domain-containing protein 2 {Human (Homo sapie 92.83
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), E2 M [TaxId: 9606]
Probab=100.00  E-value=4.9e-48  Score=293.02  Aligned_cols=156  Identities=67%  Similarity=1.210  Sum_probs=150.5

Q ss_pred             CcHHHHHHHHHHHhcCCCCCccEeecCCCCCcceEEEEEeCCCCCCCCcEEEEEEEeCCCCCCCCCcceeeccceecccc
Q 030095           27 QSAGELRLHRDISELNLPKTCSITFPNGKDDLMNFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNID  106 (183)
Q Consensus        27 ~~~~~~RL~~El~~l~~~~~~~~~~~~~~~n~~~w~~~igp~~tpyegg~f~~~i~fp~~YP~~pP~v~f~t~i~HPnV~  106 (183)
                      ++.|.+||++|+++|+.++++.+.++. ++|+++|+++|||++|||+||.|+++|.||++||++||+|+|.|++|||||+
T Consensus         1 ~~~a~~Rl~kEl~~l~~~~~~~i~~~~-~~~l~~w~~~i~p~~t~Y~gg~f~~~i~fp~~YP~~pP~V~f~t~i~HPnv~   79 (157)
T d1y8xa1           1 ASAAQLRIQKDINELNLPKTCDISFSD-PDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNID   79 (157)
T ss_dssp             CCHHHHHHHHHHHTCCCCTTEEEECSS-TTCTTEEEEEECCSSSTTTTBCEEEEEECCTTTTTSCCEEEECSCCCBTTBC
T ss_pred             CCHHHHHHHHHHHHhCCCCCCcEEEcC-CCcceEEEEEECCCCCCcCCCeEEEEEEecCCCCCCCceeeecccCCCcccc
Confidence            478999999999999888888888665 7899999999999999999999999999999999999999999999999999


Q ss_pred             CCCcEeccccCCccCCCCCHHHHHHHHHHhhcCCCCCCcccHHHHHHHhhCHHHHHHHHHHHHhcCCCCccccccCC
Q 030095          107 LEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFIRCI  183 (183)
Q Consensus       107 ~~G~icl~~l~~~W~p~~~i~~il~~i~~ll~~p~~~~~~n~~aa~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~  183 (183)
                      .+|.||++++.++|+|++++++||.+|+++|.+|++++|+|.+||++|++|+++|+++||+|++++++..+.|.+||
T Consensus        80 ~~G~ic~~~~~~~W~p~~~i~~il~~I~~ll~~Pn~~~p~n~eaa~l~~~~~~~f~~~v~~~~~~~~~~~~~~~~~~  156 (157)
T d1y8xa1          80 LEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCL  156 (157)
T ss_dssp             TTCBBCCGGGTTTCCTTCCHHHHHHHHHHHHHSCCCSSCSCHHHHHHHHSCHHHHHHHHHHHHHSEEETTEEECCCB
T ss_pred             ccceeeeeecccCCCCCCcHHHHHHHHHHHHcCCCCcChHHHHHHHHHHHCHHHHHHHHHHHHcCCCcCCEecchhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999986



>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure