BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030100
         (183 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1CA9|A Chain A, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A Peptide From Tnf-R2
 pdb|1CA9|B Chain B, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A Peptide From Tnf-R2
 pdb|1CA9|C Chain C, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A Peptide From Tnf-R2
 pdb|1CA9|D Chain D, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A Peptide From Tnf-R2
 pdb|1CA9|E Chain E, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A Peptide From Tnf-R2
 pdb|1CA9|F Chain F, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A Peptide From Tnf-R2
          Length = 192

 Score = 28.1 bits (61), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 29/67 (43%)

Query: 65  ASNYKHV--WKIENFSKK---------------------------IKLYPKGQGVGRGSH 95
           AS Y  V  WKI +F++K                           +++Y  G G GRG+H
Sbjct: 38  ASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTH 97

Query: 96  ISVYLAL 102
           +S++  +
Sbjct: 98  LSLFFVV 104


>pdb|2Y7C|A Chain A, Atomic Model Of The Ocr-Bound Methylase Complex From The
          Type I Restriction-Modification Enzyme Ecoki (M2s1).
          Based On Fitting Into Em Map 1534.
 pdb|2Y7H|A Chain A, Atomic Model Of The Dna-Bound Methylase Complex From The
          Type I Restriction-Modification Enzyme Ecoki (M2s1).
          Based On Fitting Into Em Map 1534
          Length = 464

 Score = 28.1 bits (61), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 5/58 (8%)

Query: 3  KERRFHVLKLEWGFDQFIPLEEFNDASNGYLVGDTCVFGAEVLVKERNKCKGECLFLA 60
          KE+  + LK     D ++PL   N+  NG       VF  + LVKE  K   E + +A
Sbjct: 29 KEQAINYLK-----DDYLPLIRANNIQNGKFDTTDLVFVPKNLVKESQKISPEDIVIA 81


>pdb|4HPV|A Chain A, Crystal Structure Of S-Adenosylmethionine Synthetase From
           Sulfolobus Solfataricus 982
 pdb|4HPV|B Chain B, Crystal Structure Of S-Adenosylmethionine Synthetase From
           Sulfolobus Solfataricus 982
          Length = 407

 Score = 28.1 bits (61), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 24/39 (61%)

Query: 89  GVGRGSHISVYLALADLSTITRDSKIYVHFTLRIRDQVL 127
           G+ RG+ + + +A A +S +  D   Y++   ++R+Q+L
Sbjct: 207 GLRRGNEVDLTIAXATISELIEDVNHYINVKEQVRNQIL 245


>pdb|1CA4|A Chain A, Structure Of Tnf Receptor Associated Factor 2 (Traf2)
 pdb|1CA4|B Chain B, Structure Of Tnf Receptor Associated Factor 2 (Traf2)
 pdb|1CA4|C Chain C, Structure Of Tnf Receptor Associated Factor 2 (Traf2)
 pdb|1CA4|D Chain D, Structure Of Tnf Receptor Associated Factor 2 (Traf2)
 pdb|1CA4|E Chain E, Structure Of Tnf Receptor Associated Factor 2 (Traf2)
 pdb|1CA4|F Chain F, Structure Of Tnf Receptor Associated Factor 2 (Traf2)
 pdb|1D00|A Chain A, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A 5-Residue Cd40 Peptide
 pdb|1D00|B Chain B, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A 5-Residue Cd40 Peptide
 pdb|1D00|C Chain C, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A 5-Residue Cd40 Peptide
 pdb|1D00|D Chain D, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A 5-Residue Cd40 Peptide
 pdb|1D00|E Chain E, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A 5-Residue Cd40 Peptide
 pdb|1D00|F Chain F, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A 5-Residue Cd40 Peptide
 pdb|1D00|G Chain G, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A 5-Residue Cd40 Peptide
 pdb|1D00|H Chain H, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A 5-Residue Cd40 Peptide
 pdb|1D0J|A Chain A, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A M4-1bb Peptide
 pdb|1D0J|B Chain B, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A M4-1bb Peptide
 pdb|1D0J|C Chain C, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A M4-1bb Peptide
 pdb|1D0J|D Chain D, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A M4-1bb Peptide
 pdb|1D0J|E Chain E, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A M4-1bb Peptide
 pdb|1D0J|F Chain F, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A M4-1bb Peptide
          Length = 168

 Score = 28.1 bits (61), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 29/67 (43%)

Query: 65  ASNYKHV--WKIENFSKK---------------------------IKLYPKGQGVGRGSH 95
           AS Y  V  WKI +F++K                           +++Y  G G GRG+H
Sbjct: 14  ASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTH 73

Query: 96  ISVYLAL 102
           +S++  +
Sbjct: 74  LSLFFVV 80


>pdb|1QY5|A Chain A, Crystal Structure Of The N-Domain Of The Er Hsp90
           Chaperone Grp94 In Complex With The Specific Ligand Neca
 pdb|1QY8|A Chain A, Crystal Structure Of The N-domain Of The Er Hsp90
           Chaperone Grp94 In Complex With Radicicol
 pdb|1QYE|A Chain A, Crystal Structure Of The N-domain Of The Er Hsp90
           Chaperone Grp94 In Complex With 2-chlorodideoxyadenosine
          Length = 269

 Score = 27.7 bits (60), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/65 (18%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 66  SNYKHVWKIENFSKKIKLYPKGQGVGRGSHISV--------YLALADLSTITRDSKIYVH 117
           ++ +H+W+ ++    +   P+G  +GRG+ I++        YL L  +  + +    +++
Sbjct: 149 NDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFIN 208

Query: 118 FTLRI 122
           F + +
Sbjct: 209 FPIYV 213


>pdb|1QSC|A Chain A, Crystal Structure Of The Traf Domain Of Traf2 In A Complex
           With A Peptide From The Cd40 Receptor
 pdb|1QSC|B Chain B, Crystal Structure Of The Traf Domain Of Traf2 In A Complex
           With A Peptide From The Cd40 Receptor
 pdb|1QSC|C Chain C, Crystal Structure Of The Traf Domain Of Traf2 In A Complex
           With A Peptide From The Cd40 Receptor
          Length = 191

 Score = 27.7 bits (60), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 29/67 (43%)

Query: 65  ASNYKHV--WKIENFSKK---------------------------IKLYPKGQGVGRGSH 95
           AS Y  V  WKI +F++K                           +++Y  G G GRG+H
Sbjct: 37  ASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKXCLRIYLNGDGTGRGTH 96

Query: 96  ISVYLAL 102
           +S++  +
Sbjct: 97  LSLFFVV 103


>pdb|1CZZ|A Chain A, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A 17-Residue Cd40 Peptide
 pdb|1CZZ|B Chain B, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A 17-Residue Cd40 Peptide
 pdb|1CZZ|C Chain C, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A 17-Residue Cd40 Peptide
          Length = 187

 Score = 27.7 bits (60), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 27/67 (40%), Gaps = 29/67 (43%)

Query: 65  ASNYKHV--WKIENFSKK---------------------------IKLYPKGQGVGRGSH 95
           AS Y  V  WKI +F +K                           +++Y  G G GRG+H
Sbjct: 33  ASTYDGVFIWKISDFPRKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTH 92

Query: 96  ISVYLAL 102
           +S++  +
Sbjct: 93  LSLFFVV 99


>pdb|1U0Y|A Chain A, N-Domain Of Grp94, With The Charged Domain, In Complex
           With The Novel Ligand N-Propyl Carboxyamido Adenosine
 pdb|1YT2|A Chain A, Crystal Structure Of The Unliganded Form Of Grp94, The Er
           Hsp90: Basis For Nucleotide-Induced Conformational
           Change, Grp94n Apo Crystal
          Length = 273

 Score = 27.7 bits (60), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/65 (18%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 66  SNYKHVWKIENFSKKIKLYPKGQGVGRGSHISV--------YLALADLSTITRDSKIYVH 117
           ++ +H+W+ ++    +   P+G  +GRG+ I++        YL L  +  + +    +++
Sbjct: 153 NDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFIN 212

Query: 118 FTLRI 122
           F + +
Sbjct: 213 FPIYV 217


>pdb|1CZY|A Chain A, Crystal Structure Of The Complex Between The Traf Domain
           Of Human Traf2 And An Lmp1 Binding Peptide
 pdb|1CZY|B Chain B, Crystal Structure Of The Complex Between The Traf Domain
           Of Human Traf2 And An Lmp1 Binding Peptide
 pdb|1CZY|C Chain C, Crystal Structure Of The Complex Between The Traf Domain
           Of Human Traf2 And An Lmp1 Binding Peptide
 pdb|1D0A|A Chain A, Structure Of Tnf Receptor Associated Factor 2 (Traf2) In
           Complex With A Human Ox40 Peptide
 pdb|1D0A|B Chain B, Structure Of Tnf Receptor Associated Factor 2 (Traf2) In
           Complex With A Human Ox40 Peptide
 pdb|1D0A|C Chain C, Structure Of Tnf Receptor Associated Factor 2 (Traf2) In
           Complex With A Human Ox40 Peptide
 pdb|1D0A|D Chain D, Structure Of Tnf Receptor Associated Factor 2 (Traf2) In
           Complex With A Human Ox40 Peptide
 pdb|1D0A|E Chain E, Structure Of Tnf Receptor Associated Factor 2 (Traf2) In
           Complex With A Human Ox40 Peptide
 pdb|1D0A|F Chain F, Structure Of Tnf Receptor Associated Factor 2 (Traf2) In
           Complex With A Human Ox40 Peptide
 pdb|1D01|A Chain A, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A Human Cd30 Peptide
 pdb|1D01|B Chain B, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A Human Cd30 Peptide
 pdb|1D01|C Chain C, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A Human Cd30 Peptide
 pdb|1D01|D Chain D, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A Human Cd30 Peptide
 pdb|1D01|E Chain E, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A Human Cd30 Peptide
 pdb|1D01|F Chain F, Structure Of Tnf Receptor Associated Factor 2 In Complex
           With A Human Cd30 Peptide
          Length = 168

 Score = 27.7 bits (60), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 27/67 (40%), Gaps = 29/67 (43%)

Query: 65  ASNYKHV--WKIENFSKK---------------------------IKLYPKGQGVGRGSH 95
           AS Y  V  WKI +F +K                           +++Y  G G GRG+H
Sbjct: 14  ASTYDGVFIWKISDFPRKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTH 73

Query: 96  ISVYLAL 102
           +S++  +
Sbjct: 74  LSLFFVV 80


>pdb|2ESA|A Chain A, Grp94 N-Terminal Domain Bound To Geldanamycin: Effects Of
           Mutants 168- 169 Ks-Aa
          Length = 236

 Score = 27.3 bits (59), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/65 (18%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 66  SNYKHVWKIENFSKKIKLYPKGQGVGRGSHISV--------YLALADLSTITRDSKIYVH 117
           ++ +H+W+ ++    +   P+G  +GRG+ I++        YL L  +  + +    +++
Sbjct: 153 NDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFIN 212

Query: 118 FTLRI 122
           F + +
Sbjct: 213 FPIYV 217


>pdb|1U2O|A Chain A, Crystal Structure Of The N-Domain Of Grp94 Lacking The
           Charged Domain In Complex With Neca
 pdb|1U2O|B Chain B, Crystal Structure Of The N-Domain Of Grp94 Lacking The
           Charged Domain In Complex With Neca
 pdb|1TBW|A Chain A, Ligand Induced Conformational Shift In The N-Terminal
           Domain Of Grp94, Open Conformation
 pdb|1TBW|B Chain B, Ligand Induced Conformational Shift In The N-Terminal
           Domain Of Grp94, Open Conformation
 pdb|1TC0|A Chain A, Ligand Induced Conformational Shifts In The N-Terminal
           Domain Of Grp94, Open Conformation Complexed With The
           Physiological Partner Atp
 pdb|1TC0|B Chain B, Ligand Induced Conformational Shifts In The N-Terminal
           Domain Of Grp94, Open Conformation Complexed With The
           Physiological Partner Atp
 pdb|1TC6|A Chain A, Ligand Induced Conformational Shift In The N-Terminal
           Domain Of Grp94, Open Conformation Adp-Complex
 pdb|1TC6|B Chain B, Ligand Induced Conformational Shift In The N-Terminal
           Domain Of Grp94, Open Conformation Adp-Complex
 pdb|1U0Z|A Chain A, N-Domain Of Grp94 Lacking The Charged Domain In Complex
           With Radicicol
 pdb|1U0Z|B Chain B, N-Domain Of Grp94 Lacking The Charged Domain In Complex
           With Radicicol
 pdb|1YSZ|A Chain A, Crystal Structure Of The Unliganded Form Of Grp94, The Er
           Hsp90: Basis For Nucleotide-Induced Conformational
           Change, Grp94n(Delta)41 Apo Crystal Soaked With Neca
 pdb|1YT0|A Chain A, Crystal Structure Of The Unliganded Form Of Grp94, The Er
           Hsp90: Basis For Nucleotide-Induced Conformational
           Change, Grp94n(Delta)41 Apo Crystal Soaked With Adp
 pdb|1YT1|A Chain A, Crystal Structure Of The Unliganded Form Of Grp94, The Er
           Hsp90: Basis For Nucleotide-Induced Conformational
           Change, Grp94n(Delta)41 Apo Crystal
 pdb|1YT1|B Chain B, Crystal Structure Of The Unliganded Form Of Grp94, The Er
           Hsp90: Basis For Nucleotide-Induced Conformational
           Change, Grp94n(Delta)41 Apo Crystal
 pdb|2EXL|A Chain A, Grp94 N-Terminal Domain Bound To Geldanamycin
 pdb|2EXL|B Chain B, Grp94 N-Terminal Domain Bound To Geldanamycin
 pdb|2FYP|A Chain A, Grp94 In Complex With The Novel Hsp90 Inhibitor Radester
           Amine
 pdb|2FYP|B Chain B, Grp94 In Complex With The Novel Hsp90 Inhibitor Radester
           Amine
 pdb|2GFD|A Chain A, Grp94 In Complex With The Novel Hsp90 Inhibitor Radamide
 pdb|2GFD|B Chain B, Grp94 In Complex With The Novel Hsp90 Inhibitor Radamide
 pdb|2GQP|A Chain A, N-Domain Of Grp94 In Complex With The Novel Ligand
           N-Propyl Carboxyamido Adenosine
 pdb|2GQP|B Chain B, N-Domain Of Grp94 In Complex With The Novel Ligand
           N-Propyl Carboxyamido Adenosine
 pdb|2HCH|A Chain A, N-Domain Of Grp94 In Complex With The Novel Ligand N-(2-
           Amino)ethyl Carboxyamido Adenosine
 pdb|2HCH|B Chain B, N-Domain Of Grp94 In Complex With The Novel Ligand N-(2-
           Amino)ethyl Carboxyamido Adenosine
 pdb|2H8M|A Chain A, N-Domain Of Grp94 In Complex With The 2-Iodo-Neca
 pdb|2H8M|B Chain B, N-Domain Of Grp94 In Complex With The 2-Iodo-Neca
 pdb|2HG1|A Chain A, N-Domain Of Grp94 In Complex With The Novel Ligand N-(2-
           Hydroxyl)ethyl Carboxyamido Adenosine
 pdb|2HG1|B Chain B, N-Domain Of Grp94 In Complex With The Novel Ligand N-(2-
           Hydroxyl)ethyl Carboxyamido Adenosine
 pdb|3O2F|A Chain A, Structure Of The N-Domain Of Grp94 Bound To The Hsp90
           Inhibitor Pu-H54
 pdb|3O2F|B Chain B, Structure Of The N-Domain Of Grp94 Bound To The Hsp90
           Inhibitor Pu-H54
          Length = 236

 Score = 27.3 bits (59), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 12/65 (18%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 66  SNYKHVWKIENFSKKIKLYPKGQGVGRGSHISV--------YLALADLSTITRDSKIYVH 117
           ++ +H+W+ ++    +   P+G  +GRG+ I++        YL L  +  + +    +++
Sbjct: 153 NDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFIN 212

Query: 118 FTLRI 122
           F + +
Sbjct: 213 FPIYV 217


>pdb|1F3V|B Chain B, Crystal Structure Of The Complex Between The N-Terminal
           Domain Of Tradd And The Traf Domain Of Traf2
          Length = 171

 Score = 27.3 bits (59), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 8/22 (36%), Positives = 16/22 (72%)

Query: 81  IKLYPKGQGVGRGSHISVYLAL 102
           +++Y  G G GRG+H+S++  +
Sbjct: 62  LRIYLNGDGTGRGTHLSLFFVV 83


>pdb|2OAJ|A Chain A, Crystal Structure Of Sro7 From S. Cerevisiae
          Length = 902

 Score = 26.9 bits (58), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 7/86 (8%)

Query: 27  DASNGYLVGDTCVFGAEVLVKERNKCKGECLFLAKLTSASNYKHVWKIENFSKKIKLYPK 86
           DA++G+++    VF  E+ V + +  +      AK++     K  W  EN  +   L   
Sbjct: 239 DANSGHMIMARTVFETEINVPQPDYIRDSSTNAAKIS-----KVYWMCENNPEYTSLLIS 293

Query: 87  GQGVGRGSHISVYLALADLSTITRDS 112
            + + RG + S  L + DL    R S
Sbjct: 294 HKSISRGDNQS--LTMIDLGYTPRYS 317


>pdb|2O1W|A Chain A, Structure Of N-Terminal Plus Middle Domains (N+m) Of Grp94
 pdb|2O1W|B Chain B, Structure Of N-Terminal Plus Middle Domains (N+m) Of Grp94
 pdb|2O1W|C Chain C, Structure Of N-Terminal Plus Middle Domains (N+m) Of Grp94
 pdb|2O1W|D Chain D, Structure Of N-Terminal Plus Middle Domains (N+m) Of Grp94
 pdb|2O1W|E Chain E, Structure Of N-Terminal Plus Middle Domains (N+m) Of Grp94
          Length = 506

 Score = 26.9 bits (58), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 12/65 (18%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 66  SNYKHVWKIENFSKKIKLYPKGQGVGRGSHISV--------YLALADLSTITRDSKIYVH 117
           ++ +H+W+ ++    +   P+G  +GRG+ I++        YL L  +  + +    +++
Sbjct: 166 NDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFIN 225

Query: 118 FTLRI 122
           F + +
Sbjct: 226 FPIYV 230


>pdb|2O1U|A Chain A, Structure Of Full Length Grp94 With Amp-Pnp Bound
 pdb|2O1U|B Chain B, Structure Of Full Length Grp94 With Amp-Pnp Bound
 pdb|2O1V|A Chain A, Structure Of Full Length Grp94 With Adp Bound
 pdb|2O1V|B Chain B, Structure Of Full Length Grp94 With Adp Bound
          Length = 666

 Score = 26.9 bits (58), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 12/65 (18%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 66  SNYKHVWKIENFSKKIKLYPKGQGVGRGSHISV--------YLALADLSTITRDSKIYVH 117
           ++ +H+W+ ++    +   P+G  +GRG+ I++        YL L  +  + +    +++
Sbjct: 166 NDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFIN 225

Query: 118 FTLRI 122
           F + +
Sbjct: 226 FPIYV 230


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.135    0.412 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,385,560
Number of Sequences: 62578
Number of extensions: 203002
Number of successful extensions: 505
Number of sequences better than 100.0: 20
Number of HSP's better than 100.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 487
Number of HSP's gapped (non-prelim): 30
length of query: 183
length of database: 14,973,337
effective HSP length: 93
effective length of query: 90
effective length of database: 9,153,583
effective search space: 823822470
effective search space used: 823822470
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)