BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030102
         (183 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q0ACQ9|CH60_ALHEH 60 kDa chaperonin OS=Alkalilimnicola ehrlichei (strain MLHE-1)
           GN=groL PE=3 SV=1
          Length = 553

 Score = 31.2 bits (69), Expect = 4.3,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 89  APVKAGSQAAGSCQLLHIPARLDGLELAHHARKFFADVAKREM 131
           A V+ G    G   LL   A LDGLE A+H ++   ++ +R M
Sbjct: 406 AAVEEGIVPGGGTALLRAQASLDGLEYANHDQEVGINIVRRAM 448


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.320    0.133    0.395 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 62,338,426
Number of Sequences: 539616
Number of extensions: 2312129
Number of successful extensions: 5475
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5471
Number of HSP's gapped (non-prelim): 4
length of query: 183
length of database: 191,569,459
effective HSP length: 110
effective length of query: 73
effective length of database: 132,211,699
effective search space: 9651454027
effective search space used: 9651454027
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (26.6 bits)