Citrus Sinensis ID: 030111

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---

MIKLFKVKEKQRENAENANGKTPVKKQSAGELRLHRDISELNLPKTCSITFPNGKDDLMNFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFIRCI

ccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccCECcccccccEEEEEEECcccccccccEEEEEEEcccccccccccEEECccccccccccccccHHHHHcccccccccHHHHHHHHHHHHccccccccccHHHHHHHHccHHHHHHHHHHHHHccccccccccccc

MIKLF*******************************DISELNLPKTCSITFPNGKDDLMNFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFIRCI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MIKLFKVKEKQRENAENANGKTPVKKQSAGELRLHRDISELNLPKTCSITFPNGKDDLMNFEVSIRPDEGYYVGGTFVFTFQVSPIYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTIIYGLFHLFTQPNYEDPLNHEAAAVLRDNPKLFESNVRRAMAGGYVGQTFFIRCI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
NEDD8-conjugating enzyme Ubc12	Accepts the ubiquitin-like protein NEDD8/RUB1 from the ECR1-AXR1 E1 complex and catalyzes its covalent attachment to other proteins.	confident	Q9SDY5
NEDD8-conjugating enzyme Ubc12	Accepts the ubiquitin-like protein NEDD8 from the Uba3-Ula1 E1 complex and catalyzes its covalent attachment to other proteins.	probable	Q9VSF3
NEDD8-conjugating enzyme Ubc12	Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. Involved in cell proliferation.	probable	P61082

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NVU, chain C
Confidence level:very confident
Coverage over the Query: 3-183
View the alignment between query and template
View the model in PyMOL