Query         030117
Match_columns 182
No_of_seqs    133 out of 241
Neff          3.1 
Searched_HMMs 46136
Date          Fri Mar 29 08:47:30 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030117.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030117hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04570 DUF581:  Protein of un  99.9 8.3E-28 1.8E-32  168.7   4.9   51   85-135     8-58  (58)
  2 PF09889 DUF2116:  Uncharacteri  95.2   0.023   5E-07   40.4   3.1   29   94-131     4-32  (59)
  3 PF12855 Ecl1:  Life-span regul  94.6   0.019 4.1E-07   38.5   1.4   32   91-128     4-35  (43)
  4 PF06467 zf-FCS:  MYM-type Zinc  94.3   0.031 6.7E-07   35.2   1.8   34   93-126     6-42  (43)
  5 COG2075 RPL24A Ribosomal prote  91.5    0.16 3.5E-06   37.2   2.4   32   94-125     4-38  (66)
  6 COG4068 Uncharacterized protei  90.3    0.26 5.7E-06   35.9   2.5   32   94-136     9-40  (64)
  7 PRK00418 DNA gyrase inhibitor;  81.4    0.97 2.1E-05   32.6   1.6   37   93-135     6-42  (62)
  8 PF03884 DUF329:  Domain of unk  81.3    0.51 1.1E-05   33.4   0.1   33   95-133     4-36  (57)
  9 smart00746 TRASH metallochaper  79.8     2.7 5.9E-05   22.8   2.8   33   96-128     1-36  (39)
 10 PF04945 YHS:  YHS domain;  Int  79.3     1.2 2.5E-05   29.0   1.4   32   98-130     5-39  (47)
 11 PRK01343 zinc-binding protein;  77.4     1.7 3.8E-05   30.9   1.9   31   94-134    10-40  (57)
 12 PRK14891 50S ribosomal protein  76.7     2.1 4.5E-05   35.1   2.4   35   94-128     5-42  (131)
 13 PRK00807 50S ribosomal protein  76.4     2.6 5.5E-05   28.9   2.4   34   94-127     2-38  (52)
 14 PF04640 PLATZ:  PLATZ transcri  70.7     2.1 4.5E-05   31.5   0.9   23   92-123    48-70  (72)
 15 cd00472 Ribosomal_L24e_L24 Rib  65.7       6 0.00013   27.6   2.4   35   94-128     4-41  (54)
 16 PF00412 LIM:  LIM domain;  Int  65.0     4.3 9.4E-05   26.1   1.5   25   95-121    28-52  (58)
 17 PF02069 Metallothio_Pro:  Prok  60.3     6.5 0.00014   27.5   1.8   32   94-127     8-39  (52)
 18 PF11809 DUF3330:  Domain of un  57.1     4.6  0.0001   30.0   0.6   36   94-130    12-50  (70)
 19 PF15279 SOBP:  Sine oculis-bin  52.3      13 0.00027   33.9   2.7   33   96-130     2-38  (306)
 20 PHA03073 late transcription fa  49.3      11 0.00024   31.5   1.7   35   93-128    49-87  (150)
 21 COG3024 Uncharacterized protei  48.7     9.4  0.0002   28.1   1.1   36   93-134     7-42  (65)
 22 PF06906 DUF1272:  Protein of u  44.9      17 0.00037   26.1   1.9   31   94-125     6-37  (57)
 23 PF04181 RPAP2_Rtr1:  Rtr1/RPAP  42.7      29 0.00063   24.8   2.9   41   90-130    17-73  (79)
 24 PF01753 zf-MYND:  MYND finger;  41.2      21 0.00045   22.0   1.7   15  114-128    16-30  (37)
 25 PF01246 Ribosomal_L24e:  Ribos  39.9      25 0.00053   25.8   2.1   35   94-128     4-41  (71)
 26 PF12156 ATPase-cat_bd:  Putati  39.7      58  0.0013   24.0   4.1   41   95-135     2-45  (88)
 27 smart00132 LIM Zinc-binding do  34.0      40 0.00086   19.4   2.1   23   95-118     1-23  (39)
 28 PF08394 Arc_trans_TRASH:  Arch  33.7      43 0.00094   21.9   2.3   32   96-127     1-33  (37)
 29 PF10367 Vps39_2:  Vacuolar sor  31.7      34 0.00073   24.2   1.7   25   93-118    78-102 (109)
 30 KOG4357 Uncharacterized conser  31.2      20 0.00043   30.1   0.5   16  103-118   111-127 (164)
 31 PTZ00033 60S ribosomal protein  30.1      50  0.0011   26.9   2.6   35   94-128     4-45  (125)
 32 cd01224 PH_Collybistin Collybi  23.9      37  0.0008   26.8   0.8   21   94-115    28-48  (109)
 33 PF08600 Rsm1:  Rsm1-like;  Int  21.8      34 0.00074   25.4   0.3   17   93-113    19-35  (91)

No 1  
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=99.94  E-value=8.3e-28  Score=168.67  Aligned_cols=51  Identities=59%  Similarity=1.083  Sum_probs=48.0

Q ss_pred             CCCCchhHhhccccccCCCCCCCceeEEcCCccccChhHHHHHHHHHHHHh
Q 030117           85 DFLETPHFLRTCGLCKRRLVPGRDIYMYRGDSAFCSLECRQQQMNQDERKQ  135 (182)
Q Consensus        85 ~~~e~~~FL~~C~lCkK~L~~gkDIYMYRGe~AFCS~ECR~qqI~~DE~~E  135 (182)
                      ...++.+||++|++|+|+|.+++||||||||+||||.|||++||++||++|
T Consensus         8 ~~~~~~~FL~~C~~C~k~L~~~~DiymYrGd~aFCS~ECR~~qi~~de~~E   58 (58)
T PF04570_consen    8 SPFPSEHFLSFCYLCKKKLDPGKDIYMYRGDKAFCSEECRSQQILMDEEKE   58 (58)
T ss_pred             CCCCcHHHHHHHHccCCCCCCCCCeeeeccccccccHHHHHHHHHHHHhcC
Confidence            345788999999999999999999999999999999999999999999986


No 2  
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=95.15  E-value=0.023  Score=40.36  Aligned_cols=29  Identities=31%  Similarity=0.918  Sum_probs=23.4

Q ss_pred             hccccccCCCCCCCceeEEcCCccccChhHHHHHHHHH
Q 030117           94 RTCGLCKRRLVPGRDIYMYRGDSAFCSLECRQQQMNQD  131 (182)
Q Consensus        94 ~~C~lCkK~L~~gkDIYMYRGe~AFCS~ECR~qqI~~D  131 (182)
                      +.|-.|.+.+.+         |..|||.+||+.....-
T Consensus         4 kHC~~CG~~Ip~---------~~~fCS~~C~~~~~k~q   32 (59)
T PF09889_consen    4 KHCPVCGKPIPP---------DESFCSPKCREEYRKRQ   32 (59)
T ss_pred             CcCCcCCCcCCc---------chhhhCHHHHHHHHHHH
Confidence            469999999964         58999999998776543


No 3  
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=94.56  E-value=0.019  Score=38.49  Aligned_cols=32  Identities=34%  Similarity=0.760  Sum_probs=25.4

Q ss_pred             hHhhccccccCCCCCCCceeEEcCCccccChhHHHHHH
Q 030117           91 HFLRTCGLCKRRLVPGRDIYMYRGDSAFCSLECRQQQM  128 (182)
Q Consensus        91 ~FL~~C~lCkK~L~~gkDIYMYRGe~AFCS~ECR~qqI  128 (182)
                      .|+.+|-.|-|.+....|      +..+||++||..-.
T Consensus         4 ~F~~yC~~Cdk~~~~~~~------~~lYCSe~Cr~~D~   35 (43)
T PF12855_consen    4 AFNDYCIVCDKQIDPPDD------GSLYCSEECRLKDQ   35 (43)
T ss_pred             hhhhHHHHhhccccCCCC------CccccCHHHHhHhh
Confidence            799999999999955333      46679999997643


No 4  
>PF06467 zf-FCS:  MYM-type Zinc finger with FCS sequence motif;  InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  MYM-type zinc fingers were identified in MYM family proteins []. Human protein Q14202 from SWISSPROT is involved in a chromosomal translocation and may be responsible for X-linked retardation in XQ13.1 []. Q9UBW7 from SWISSPROT is also involved in disease. In myeloproliferative disorders it is fused to FGF receptor 1 []; in atypical myeloproliferative disorders it is rearranged []. Members of the family generally are involved in development. This Zn-finger domain functions as a transcriptional trans-activator of late vaccinia viral genes, and orthologues are also found in all nucleocytoplasmic large DNA viruses, NCLDV. This domain is also found fused to the C termini of recombinases from certain prokaryotic transposons []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2L8E_A 2DAS_A.
Probab=94.25  E-value=0.031  Score=35.20  Aligned_cols=34  Identities=29%  Similarity=0.709  Sum_probs=22.0

Q ss_pred             hhccccccCCCCCCCc--eeEEcCC-ccccChhHHHH
Q 030117           93 LRTCGLCKRRLVPGRD--IYMYRGD-SAFCSLECRQQ  126 (182)
Q Consensus        93 L~~C~lCkK~L~~gkD--IYMYRGe-~AFCS~ECR~q  126 (182)
                      ...|..|++.+....+  +..|.|. .-|||..|+..
T Consensus         6 ~~~C~~C~~~~~~~~~~~~~~~~g~~~~FCS~~C~~~   42 (43)
T PF06467_consen    6 MKTCSYCKKYIPNKPTMIEVQYDGKMKQFCSQSCLSS   42 (43)
T ss_dssp             CEE-TTT--EEECCC----EE-TTTTSCCSSHHHHHH
T ss_pred             CCcCcccCCcccCCCccccccccCcccChhCHHHHhh
Confidence            3579999999955555  6777765 78999999875


No 5  
>COG2075 RPL24A Ribosomal protein L24E [Translation, ribosomal structure and biogenesis]
Probab=91.47  E-value=0.16  Score=37.20  Aligned_cols=32  Identities=38%  Similarity=0.986  Sum_probs=28.3

Q ss_pred             hccccccCCCCCCCceeEEcCCc---cccChhHHH
Q 030117           94 RTCGLCKRRLVPGRDIYMYRGDS---AFCSLECRQ  125 (182)
Q Consensus        94 ~~C~lCkK~L~~gkDIYMYRGe~---AFCS~ECR~  125 (182)
                      ..|++|.+.|.||.-|+--|.|.   -|||..|+.
T Consensus         4 ~~CsFcG~~I~PGtG~m~Vr~Dg~v~~FcssKc~k   38 (66)
T COG2075           4 RVCSFCGKKIEPGTGIMYVRNDGKVLRFCSSKCEK   38 (66)
T ss_pred             eEecCcCCccCCCceEEEEecCCeEEEEechhHHH
Confidence            46999999999999988878885   499999998


No 6  
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=90.28  E-value=0.26  Score=35.90  Aligned_cols=32  Identities=34%  Similarity=0.808  Sum_probs=24.4

Q ss_pred             hccccccCCCCCCCceeEEcCCccccChhHHHHHHHHHHHHhh
Q 030117           94 RTCGLCKRRLVPGRDIYMYRGDSAFCSLECRQQQMNQDERKQK  136 (182)
Q Consensus        94 ~~C~lCkK~L~~gkDIYMYRGe~AFCS~ECR~qqI~~DE~~Ek  136 (182)
                      +.|--|.|.|.+|         .-|||+||+  +|+..|++-+
T Consensus         9 ~HC~VCg~aIp~d---------e~~CSe~C~--eil~ker~R~   40 (64)
T COG4068           9 RHCVVCGKAIPPD---------EQVCSEECG--EILNKERKRQ   40 (64)
T ss_pred             ccccccCCcCCCc---------cchHHHHHH--HHHHHHHHHH
Confidence            4588999999754         469999997  5777776644


No 7  
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=81.41  E-value=0.97  Score=32.63  Aligned_cols=37  Identities=22%  Similarity=0.501  Sum_probs=25.4

Q ss_pred             hhccccccCCCCCCCceeEEcCCccccChhHHHHHHHHHHHHh
Q 030117           93 LRTCGLCKRRLVPGRDIYMYRGDSAFCSLECRQQQMNQDERKQ  135 (182)
Q Consensus        93 L~~C~lCkK~L~~gkDIYMYRGe~AFCS~ECR~qqI~~DE~~E  135 (182)
                      ...|--|+|... +..-.-|   .+|||..|+  .|.+-++..
T Consensus         6 ~v~CP~C~k~~~-w~~~~~~---rPFCS~RCk--~IDLg~W~~   42 (62)
T PRK00418          6 TVNCPTCGKPVE-WGEISPF---RPFCSKRCQ--LIDLGEWAA   42 (62)
T ss_pred             cccCCCCCCccc-ccCCCCc---CCcccHHHH--hhhHHHHHc
Confidence            457999999974 2222334   489999987  577777653


No 8  
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=81.25  E-value=0.51  Score=33.41  Aligned_cols=33  Identities=18%  Similarity=0.415  Sum_probs=17.7

Q ss_pred             ccccccCCCCCCCceeEEcCCccccChhHHHHHHHHHHH
Q 030117           95 TCGLCKRRLVPGRDIYMYRGDSAFCSLECRQQQMNQDER  133 (182)
Q Consensus        95 ~C~lCkK~L~~gkDIYMYRGe~AFCS~ECR~qqI~~DE~  133 (182)
                      .|--|+|.... .+-.=   -.+|||..||  .|.+-.+
T Consensus         4 ~CP~C~k~~~~-~~~n~---~rPFCS~RCk--~iDLg~W   36 (57)
T PF03884_consen    4 KCPICGKPVEW-SPENP---FRPFCSERCK--LIDLGRW   36 (57)
T ss_dssp             E-TTT--EEE--SSSSS-----SSSSHHHH--HHHHS-S
T ss_pred             cCCCCCCeecc-cCCCC---cCCcccHhhc--ccCHHHH
Confidence            58889998843 22222   3699999998  4655444


No 9  
>smart00746 TRASH metallochaperone-like domain.
Probab=79.75  E-value=2.7  Score=22.85  Aligned_cols=33  Identities=27%  Similarity=0.734  Sum_probs=20.8

Q ss_pred             cccccCCCC-CCCc-eeEEcCC-ccccChhHHHHHH
Q 030117           96 CGLCKRRLV-PGRD-IYMYRGD-SAFCSLECRQQQM  128 (182)
Q Consensus        96 C~lCkK~L~-~gkD-IYMYRGe-~AFCS~ECR~qqI  128 (182)
                      |..|++.+. +... .+.+.|. .-|||.+|.....
T Consensus         1 c~~C~~~~~~~~~~~~~~~~g~~~~FCs~~c~~~~~   36 (39)
T smart00746        1 CSFCGKDIYNPGTGIMVVNDGKVFYFCSSKCLSKFK   36 (39)
T ss_pred             CCCCCCCccCCCCceEEEECCEEEEEeCHHHHHHHH
Confidence            677888885 3322 2234442 4799999987543


No 10 
>PF04945 YHS:  YHS domain;  InterPro: IPR007029 This short presumed domain is about 50 amino acid residues long. It often contains two cysteines that may be functionally important. This domain is found in copper transporting ATPases, some phenol hydroxylases and in a set of uncharacterised membrane proteins including Q9CNI0 from SWISSPROT. This domain is named after three of the most conserved amino acids it contains. The domain may be metal binding, possibly copper ions. This domain is duplicated in some copper transporting ATPases.; PDB: 3U52_B 2INN_A 2INP_B 1T0Q_A 2RDB_A 1T0R_A 2IND_A 1T0S_A 2INC_A 3DHI_A ....
Probab=79.29  E-value=1.2  Score=28.99  Aligned_cols=32  Identities=28%  Similarity=0.641  Sum_probs=21.7

Q ss_pred             cccCCCCCC--CceeEEcCC-ccccChhHHHHHHHH
Q 030117           98 LCKRRLVPG--RDIYMYRGD-SAFCSLECRQQQMNQ  130 (182)
Q Consensus        98 lCkK~L~~g--kDIYMYRGe-~AFCS~ECR~qqI~~  130 (182)
                      -|...| ++  ...+.|+|. --|||.+|++.....
T Consensus         5 vcg~~v-~~~~~~~~~y~G~~Y~FCS~~C~~~F~~~   39 (47)
T PF04945_consen    5 VCGMKV-PGNAAYSVEYNGRTYYFCSEGCKEKFEAN   39 (47)
T ss_dssp             GGG-BE------EEEEETTEEEEESSHHHHHHHHCS
T ss_pred             CCCCEE-ccCccEEEEECCEEEEEcCHHHHHHHHHC
Confidence            477788 33  466788887 589999999876543


No 11 
>PRK01343 zinc-binding protein; Provisional
Probab=77.40  E-value=1.7  Score=30.90  Aligned_cols=31  Identities=26%  Similarity=0.587  Sum_probs=22.7

Q ss_pred             hccccccCCCCCCCceeEEcCCccccChhHHHHHHHHHHHH
Q 030117           94 RTCGLCKRRLVPGRDIYMYRGDSAFCSLECRQQQMNQDERK  134 (182)
Q Consensus        94 ~~C~lCkK~L~~gkDIYMYRGe~AFCS~ECR~qqI~~DE~~  134 (182)
                      ..|--|+|... +    =   ..+|||..||.  |.+-.+.
T Consensus        10 ~~CP~C~k~~~-~----~---~rPFCS~RC~~--iDLg~W~   40 (57)
T PRK01343         10 RPCPECGKPST-R----E---AYPFCSERCRD--IDLNRWL   40 (57)
T ss_pred             CcCCCCCCcCc-C----C---CCcccCHHHhh--hhHHHHh
Confidence            57999999874 1    1   35999999985  6666654


No 12 
>PRK14891 50S ribosomal protein L24e/unknown domain fusion protein; Provisional
Probab=76.74  E-value=2.1  Score=35.09  Aligned_cols=35  Identities=26%  Similarity=0.516  Sum_probs=27.4

Q ss_pred             hccccccCCCCCCCceeEEcCC---ccccChhHHHHHH
Q 030117           94 RTCGLCKRRLVPGRDIYMYRGD---SAFCSLECRQQQM  128 (182)
Q Consensus        94 ~~C~lCkK~L~~gkDIYMYRGe---~AFCS~ECR~qqI  128 (182)
                      ..|++|..+|-||.-|-.-|.|   --|||..|....+
T Consensus         5 e~CsFcG~kIyPG~G~~fVR~DGkvf~FcssKC~k~f~   42 (131)
T PRK14891          5 RTCDYTGEEIEPGTGTMFVRKDGTVLHFVDSKCEKNYD   42 (131)
T ss_pred             eeecCcCCcccCCCCcEEEecCCCEEEEecHHHHHHHH
Confidence            4799999999999876555655   3599999976554


No 13 
>PRK00807 50S ribosomal protein L24e; Validated
Probab=76.42  E-value=2.6  Score=28.94  Aligned_cols=34  Identities=32%  Similarity=0.786  Sum_probs=27.2

Q ss_pred             hccccccCCCCCCCceeEEcCC---ccccChhHHHHH
Q 030117           94 RTCGLCKRRLVPGRDIYMYRGD---SAFCSLECRQQQ  127 (182)
Q Consensus        94 ~~C~lCkK~L~~gkDIYMYRGe---~AFCS~ECR~qq  127 (182)
                      ..|..|..+|.||.-+..++.|   --|||..|....
T Consensus         2 ~~C~fcG~~I~pg~G~~~vr~Dgkv~~Fcs~KC~~~f   38 (52)
T PRK00807          2 RTCSFCGKEIEPGTGKMYVKKDGTILYFCSSKCEKNY   38 (52)
T ss_pred             cccCCCCCeEcCCCCeEEEEeCCcEEEEeCHHHHHHH
Confidence            4699999999989887766655   469999997654


No 14 
>PF04640 PLATZ:  PLATZ transcription factor;  InterPro: IPR006734 This family includes a conserved region in several uncharacterised plant proteins.
Probab=70.67  E-value=2.1  Score=31.55  Aligned_cols=23  Identities=48%  Similarity=0.966  Sum_probs=18.4

Q ss_pred             HhhccccccCCCCCCCceeEEcCCccccChhH
Q 030117           92 FLRTCGLCKRRLVPGRDIYMYRGDSAFCSLEC  123 (182)
Q Consensus        92 FL~~C~lCkK~L~~gkDIYMYRGe~AFCS~EC  123 (182)
                      +...|..|.+.|.   |-  |    -|||..|
T Consensus        48 ~~~~C~~C~R~L~---d~--~----~fCSl~C   70 (72)
T PF04640_consen   48 SGNICETCHRSLQ---DP--Y----RFCSLSC   70 (72)
T ss_pred             CCCccCCCCCCCC---CC--C----eEEeeeE
Confidence            6688999999995   33  3    3899988


No 15 
>cd00472 Ribosomal_L24e_L24 Ribosomal protein L24e/L24 is a ribosomal protein found in eukaryotes (L24) and in archaea (L24e, distinct from archaeal L24). L24e/L24 is located on the surface of the large subunit, adjacent to proteins L14 and L3, and near the translation factor binding site.  L24e/L24 appears to play a role in the kinetics of peptide synthesis, and may be involved in interactions between the large and small subunits, either directly or through other factors. In mouse, a deletion mutation in L24 has been identified as the cause for the belly spot and tail (Bst) mutation that results in disrupted pigmentation, somitogenesis and retinal cell fate determination.  L24 may be an important protein in eukaryotic reproduction:  in shrimp, L24 expression is elevated in the ovary, suggesting a role in oogenesis, and in Arabidopsis, L24 has been proposed to have a specific function in gynoecium development. No protein with sequence or structural homology to L24e/L24 has been identifi
Probab=65.71  E-value=6  Score=27.62  Aligned_cols=35  Identities=29%  Similarity=0.785  Sum_probs=28.3

Q ss_pred             hccccccCCCCCCCceeEEcCCc---cccChhHHHHHH
Q 030117           94 RTCGLCKRRLVPGRDIYMYRGDS---AFCSLECRQQQM  128 (182)
Q Consensus        94 ~~C~lCkK~L~~gkDIYMYRGe~---AFCS~ECR~qqI  128 (182)
                      ..|.+|..+|.||.-+-.-|.|.   -|||..|+...+
T Consensus         4 ~~C~f~g~~I~PG~G~~~Vr~Dgkv~~F~s~Kc~~~~~   41 (54)
T cd00472           4 EKCSFCGYKIYPGHGKMYVRNDGKVFRFCSSKCEKNFL   41 (54)
T ss_pred             EEecCcCCeecCCCccEEEecCCCEEEEECHHHHHHHH
Confidence            46999999999998776667673   599999976554


No 16 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=65.04  E-value=4.3  Score=26.13  Aligned_cols=25  Identities=20%  Similarity=0.636  Sum_probs=18.0

Q ss_pred             ccccccCCCCCCCceeEEcCCccccCh
Q 030117           95 TCGLCKRRLVPGRDIYMYRGDSAFCSL  121 (182)
Q Consensus        95 ~C~lCkK~L~~gkDIYMYRGe~AFCS~  121 (182)
                      .|..|++.|..+.  |....++.||..
T Consensus        28 ~C~~C~~~l~~~~--~~~~~~~~~C~~   52 (58)
T PF00412_consen   28 KCSKCGKPLNDGD--FYEKDGKPYCKD   52 (58)
T ss_dssp             BETTTTCBTTTSS--EEEETTEEEEHH
T ss_pred             ccCCCCCccCCCe--eEeECCEEECHH
Confidence            5889999996554  444545899865


No 17 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=60.34  E-value=6.5  Score=27.55  Aligned_cols=32  Identities=16%  Similarity=0.419  Sum_probs=17.8

Q ss_pred             hccccccCCCCCCCceeEEcCCccccChhHHHHH
Q 030117           94 RTCGLCKRRLVPGRDIYMYRGDSAFCSLECRQQQ  127 (182)
Q Consensus        94 ~~C~lCkK~L~~gkDIYMYRGe~AFCS~ECR~qq  127 (182)
                      -.|..|+=.+..... ++ +.-+.|||.+|-..+
T Consensus         8 CaC~~C~C~V~~~~A-i~-~dGk~YCS~aCA~gH   39 (52)
T PF02069_consen    8 CACPSCSCVVSEEEA-IQ-KDGKYYCSEACANGH   39 (52)
T ss_dssp             -SSTT----B-TTTS-EE-SSS-EESSHHHHHTS
T ss_pred             ecCCCCEeEECchHh-HH-hCCEeeecHHHhccC
Confidence            467888888865433 44 556999999997765


No 18 
>PF11809 DUF3330:  Domain of unknown function (DUF3330);  InterPro: IPR021767  This family of proteins are functionally uncharacterised. This family is only found in bacteria. 
Probab=57.14  E-value=4.6  Score=30.04  Aligned_cols=36  Identities=22%  Similarity=0.546  Sum_probs=23.4

Q ss_pred             hccccccCCCCCCCceeEEcCC---ccccChhHHHHHHHH
Q 030117           94 RTCGLCKRRLVPGRDIYMYRGD---SAFCSLECRQQQMNQ  130 (182)
Q Consensus        94 ~~C~lCkK~L~~gkDIYMYRGe---~AFCS~ECR~qqI~~  130 (182)
                      ..|..|.|.|- -.-.+.--|+   .-||..||-++-...
T Consensus        12 ~sC~vC~KEIP-l~~a~t~E~~eYV~hFCGLeCY~~w~a~   50 (70)
T PF11809_consen   12 TSCCVCCKEIP-LDAAFTPEAAEYVEHFCGLECYQRWQAR   50 (70)
T ss_pred             chHHHHhhhCC-hhhccCcchHHHHHHHhhHHHHHHHHHH
Confidence            46888999884 3333333332   569999997766543


No 19 
>PF15279 SOBP:  Sine oculis-binding protein
Probab=52.26  E-value=13  Score=33.93  Aligned_cols=33  Identities=30%  Similarity=0.586  Sum_probs=20.6

Q ss_pred             cccccCCCCCCCceeEEcCC----ccccChhHHHHHHHH
Q 030117           96 CGLCKRRLVPGRDIYMYRGD----SAFCSLECRQQQMNQ  130 (182)
Q Consensus        96 C~lCkK~L~~gkDIYMYRGe----~AFCS~ECR~qqI~~  130 (182)
                      |-+||. +++.++ |+=-||    --|||..|..|+-+.
T Consensus         2 cdwckh-~rh~~~-y~d~~~g~~~lqfcs~kclnqykm~   38 (306)
T PF15279_consen    2 CDWCKH-VRHTKS-YVDFQDGERQLQFCSDKCLNQYKMD   38 (306)
T ss_pred             ccchhc-ccchhh-eeccccchHHhhhccHHHHhHHHHH
Confidence            667753 434443 554444    359999999986543


No 20 
>PHA03073 late transcription factor VLTF-2; Provisional
Probab=49.29  E-value=11  Score=31.54  Aligned_cols=35  Identities=29%  Similarity=0.615  Sum_probs=25.4

Q ss_pred             hhccccccCCCCCCCceeEE---cCC-ccccChhHHHHHH
Q 030117           93 LRTCGLCKRRLVPGRDIYMY---RGD-SAFCSLECRQQQM  128 (182)
Q Consensus        93 L~~C~lCkK~L~~gkDIYMY---RGe-~AFCS~ECR~qqI  128 (182)
                      -..|-+|+..|.. .++++=   .|. ..|||.=||+-.-
T Consensus        49 ~~~CwfC~q~~~~-~~~~iETl~g~~vg~FCS~ICRDSfa   87 (150)
T PHA03073         49 NDYCWFCKQDLII-APLFIETLKGGAVGYFCSKICRDSFA   87 (150)
T ss_pred             CCcEEeecccccc-CceEEEeecCchhhhHhHHHHHHHHH
Confidence            3579999999964 456653   323 6899999998643


No 21 
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=48.69  E-value=9.4  Score=28.06  Aligned_cols=36  Identities=22%  Similarity=0.511  Sum_probs=25.3

Q ss_pred             hhccccccCCCCCCCceeEEcCCccccChhHHHHHHHHHHHH
Q 030117           93 LRTCGLCKRRLVPGRDIYMYRGDSAFCSLECRQQQMNQDERK  134 (182)
Q Consensus        93 L~~C~lCkK~L~~gkDIYMYRGe~AFCS~ECR~qqI~~DE~~  134 (182)
                      -..|-.|.|... +.++==|   .+|||..|.  .|.+-++.
T Consensus         7 ~v~CP~Cgkpv~-w~~~s~f---rPFCSkRCk--lIDLg~Wa   42 (65)
T COG3024           7 TVPCPTCGKPVV-WGEESPF---RPFCSKRCK--LIDLGEWA   42 (65)
T ss_pred             cccCCCCCCccc-ccccCCc---CcchhHhhh--hcchhhhh
Confidence            456999999984 4343344   499999875  67777764


No 22 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=44.86  E-value=17  Score=26.13  Aligned_cols=31  Identities=26%  Similarity=0.833  Sum_probs=25.1

Q ss_pred             hccccccCCCCCCC-ceeEEcCCccccChhHHH
Q 030117           94 RTCGLCKRRLVPGR-DIYMYRGDSAFCSLECRQ  125 (182)
Q Consensus        94 ~~C~lCkK~L~~gk-DIYMYRGe~AFCS~ECR~  125 (182)
                      -.|-.|.+.|.++. |.||.--|=-||. +|-+
T Consensus         6 pnCE~C~~dLp~~s~~A~ICSfECTFC~-~C~e   37 (57)
T PF06906_consen    6 PNCECCDKDLPPDSPEAYICSFECTFCA-DCAE   37 (57)
T ss_pred             CCccccCCCCCCCCCcceEEeEeCcccH-HHHH
Confidence            35889999998887 9999988899985 4543


No 23 
>PF04181 RPAP2_Rtr1:  Rtr1/RPAP2 family;  InterPro: IPR007308 This entry represents a domain found in PAP2 (RNAP II associated polypeptide) protein and the yeast Rtr1 proteins. Its function is not known however it is thought to be a zinc finger.
Probab=42.74  E-value=29  Score=24.78  Aligned_cols=41  Identities=27%  Similarity=0.420  Sum_probs=23.8

Q ss_pred             hhHhhccc--cccCCCCCC--CceeEE--------cCC----ccccChhHHHHHHHH
Q 030117           90 PHFLRTCG--LCKRRLVPG--RDIYMY--------RGD----SAFCSLECRQQQMNQ  130 (182)
Q Consensus        90 ~~FL~~C~--lCkK~L~~g--kDIYMY--------RGe----~AFCS~ECR~qqI~~  130 (182)
                      -+....|.  +|.+.+...  +..|-.        .-+    .-|||..|...-..+
T Consensus        17 R~~~~~CGYplC~~~~~~~~~~~~y~i~~~~~~v~~~~~~~~~~fCS~~C~~~s~~~   73 (79)
T PF04181_consen   17 RNINGLCGYPLCSNPPPKISSRQKYRIDLKANKVYDITERELSKFCSKDCYKASEFY   73 (79)
T ss_pred             HHhCCCCCCccCCCCcccccCCCCeEEECCCCeecccccChhcCcCCHHHHHHHHHH
Confidence            34445553  588877655  333322        211    389999998765443


No 24 
>PF01753 zf-MYND:  MYND finger;  InterPro: IPR002893 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MYND-type zinc finger domains. The MYND domain (myeloid, Nervy, and DEAF-1) is present in a large group of proteins that includes RP-8 (PDCD2), Nervy, and predicted proteins from Drosophila, mammals, Caenorhabditis elegans, yeast, and plants [, , ]. The MYND domain consists of a cluster of cysteine and histidine residues, arranged with an invariant spacing to form a potential zinc-binding motif []. Mutating conserved cysteine residues in the DEAF-1 MYND domain does not abolish DNA binding, which suggests that the MYND domain might be involved in protein-protein interactions []. Indeed, the MYND domain of ETO/MTG8 interacts directly with the N-CoR and SMRT co-repressors [, ]. Aberrant recruitment of co-repressor complexes and inappropriate transcriptional repression is believed to be a general mechanism of leukemogenesis caused by the t(8;21) translocations that fuse ETO with the acute myelogenous leukemia 1 (AML1) protein. ETO has been shown to be a co-repressor recruited by the promyelocytic leukemia zinc finger (PLZF) protein []. A divergent MYND domain present in the adenovirus E1A binding protein BS69 was also shown to interact with N-CoR and mediate transcriptional repression []. The current evidence suggests that the MYND motif in mammalian proteins constitutes a protein-protein interaction domain that functions as a co-repressor-recruiting interface. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3QWW_A 3QWV_A 3TG5_A 3S7F_A 3RIB_B 3TG4_A 3S7J_A 3S7D_A 3S7B_A 3RU0_A ....
Probab=41.20  E-value=21  Score=21.99  Aligned_cols=15  Identities=27%  Similarity=0.667  Sum_probs=12.1

Q ss_pred             CCccccChhHHHHHH
Q 030117          114 GDSAFCSLECRQQQM  128 (182)
Q Consensus       114 Ge~AFCS~ECR~qqI  128 (182)
                      ....|||.+|+....
T Consensus        16 ~~~~YCs~~Cq~~~w   30 (37)
T PF01753_consen   16 KSVYYCSEECQRADW   30 (37)
T ss_dssp             SSSEESSHHHHHHHH
T ss_pred             CCEEecCHHHHHHHH
Confidence            457899999998765


No 25 
>PF01246 Ribosomal_L24e:  Ribosomal protein L24e;  InterPro: IPR000988 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeabacterial ribosomal proteins can be grouped on the basis of sequence similarities. One of these families [] consists of mammalian ribosomal protein L24; yeast ribosomal protein L30A/B (Rp29) (YL21); Kluyveromyces lactis ribosomal protein L30; Arabidopsis thaliana ribosomal protein L24 homolog; Haloarcula marismortui ribosomal protein HL21/HL22; and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ1201. These proteins have 60 to 160 amino-acid residues. This entry represents proteins related to the L24e ribosomal proteins.; PDB: 2ZKR_u 1VQ9_U 1VQL_U 1KD1_V 1VQP_U 3CCM_U 3CD6_U 3CCL_U 3CCR_U 1Q86_V ....
Probab=39.88  E-value=25  Score=25.80  Aligned_cols=35  Identities=26%  Similarity=0.569  Sum_probs=23.7

Q ss_pred             hccccccCCCCCCCceeEEcCC---ccccChhHHHHHH
Q 030117           94 RTCGLCKRRLVPGRDIYMYRGD---SAFCSLECRQQQM  128 (182)
Q Consensus        94 ~~C~lCkK~L~~gkDIYMYRGe---~AFCS~ECR~qqI  128 (182)
                      ..|.+|..+|.||.-+..-+-|   --|||.-|+...+
T Consensus         4 ~~C~Fsg~~I~PG~G~~~Vr~DG~v~~F~s~Kc~~~~~   41 (71)
T PF01246_consen    4 EKCSFSGYKIYPGHGKMYVRNDGKVFYFCSSKCEKLFK   41 (71)
T ss_dssp             EE-TTT-SEE-SSSSEEEE-TTS-EEEESSHHHHHHHH
T ss_pred             EEecccCCccCCCCCeEEEecCCCeEEEeCHHHHHHHH
Confidence            4699999999999876544544   3599999987654


No 26 
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=39.72  E-value=58  Score=24.05  Aligned_cols=41  Identities=17%  Similarity=0.400  Sum_probs=29.4

Q ss_pred             ccccccCCCCCCCceeEEcC--CccccChhHHHHH-HHHHHHHh
Q 030117           95 TCGLCKRRLVPGRDIYMYRG--DSAFCSLECRQQQ-MNQDERKQ  135 (182)
Q Consensus        95 ~C~lCkK~L~~gkDIYMYRG--e~AFCS~ECR~qq-I~~DE~~E  135 (182)
                      .|+.|..++.++..|-+...  ++.||-.-|..-. |+.+.-.+
T Consensus         2 ~C~HCg~~~p~~~~~~~~~~g~~~~FCC~GC~~V~~~i~~~gL~   45 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKITVEIDGEERPFCCPGCQAVYQLIHENGLE   45 (88)
T ss_pred             CCCCCCCCCCCCCCeeeeeCCCccccccHHHHHHHHHHHHcchH
Confidence            59999999976776666543  4999999998754 44444333


No 27 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=34.02  E-value=40  Score=19.39  Aligned_cols=23  Identities=13%  Similarity=0.436  Sum_probs=15.4

Q ss_pred             ccccccCCCCCCCceeEEcCCccc
Q 030117           95 TCGLCKRRLVPGRDIYMYRGDSAF  118 (182)
Q Consensus        95 ~C~lCkK~L~~gkDIYMYRGe~AF  118 (182)
                      .|..|++.|.++ +.++...+..|
T Consensus         1 ~C~~C~~~i~~~-~~~~~~~~~~~   23 (39)
T smart00132        1 KCAGCGKPIRGG-ELVLRALGKVW   23 (39)
T ss_pred             CccccCCcccCC-cEEEEeCCccc
Confidence            488999999655 44554455555


No 28 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=33.72  E-value=43  Score=21.94  Aligned_cols=32  Identities=19%  Similarity=0.403  Sum_probs=22.6

Q ss_pred             cccccCCCCCCCceeEEcCC-ccccChhHHHHH
Q 030117           96 CGLCKRRLVPGRDIYMYRGD-SAFCSLECRQQQ  127 (182)
Q Consensus        96 C~lCkK~L~~gkDIYMYRGe-~AFCS~ECR~qq  127 (182)
                      |-+|.+.|...--+|=+.+. --||+..|..+.
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~fCC~tC~~~f   33 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYYFCCPTCLSQF   33 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEEEECHHHHHHH
Confidence            78899999644444555443 359999998764


No 29 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=31.67  E-value=34  Score=24.22  Aligned_cols=25  Identities=12%  Similarity=0.324  Sum_probs=17.3

Q ss_pred             hhccccccCCCCCCCceeEEcCCccc
Q 030117           93 LRTCGLCKRRLVPGRDIYMYRGDSAF  118 (182)
Q Consensus        93 L~~C~lCkK~L~~gkDIYMYRGe~AF  118 (182)
                      -..|..|+|+|.. ..+++|--...|
T Consensus        78 ~~~C~vC~k~l~~-~~f~~~p~~~v~  102 (109)
T PF10367_consen   78 STKCSVCGKPLGN-SVFVVFPCGHVV  102 (109)
T ss_pred             CCCccCcCCcCCC-ceEEEeCCCeEE
Confidence            3569999999964 677777532444


No 30 
>KOG4357 consensus Uncharacterized conserved protein (involved in mesoderm differentiation in humans) [General function prediction only]
Probab=31.19  E-value=20  Score=30.07  Aligned_cols=16  Identities=38%  Similarity=0.912  Sum_probs=13.6

Q ss_pred             CCCCCceeEEc-CCccc
Q 030117          103 LVPGRDIYMYR-GDSAF  118 (182)
Q Consensus       103 L~~gkDIYMYR-Ge~AF  118 (182)
                      +..++-|||++ |+.||
T Consensus       111 i~ddraifm~kdge~a~  127 (164)
T KOG4357|consen  111 IDDDRAIFMFKDGEQAF  127 (164)
T ss_pred             ecCCeEEEEEeChhHHH
Confidence            46789999998 88888


No 31 
>PTZ00033 60S ribosomal protein L24; Provisional
Probab=30.07  E-value=50  Score=26.94  Aligned_cols=35  Identities=17%  Similarity=0.271  Sum_probs=26.9

Q ss_pred             hccccccCCCCCCCceeEEc----CC---ccccChhHHHHHH
Q 030117           94 RTCGLCKRRLVPGRDIYMYR----GD---SAFCSLECRQQQM  128 (182)
Q Consensus        94 ~~C~lCkK~L~~gkDIYMYR----Ge---~AFCS~ECR~qqI  128 (182)
                      ..|++|..+|.||.-+-.-+    .|   --|||.-|....+
T Consensus         4 ~~C~Fsg~~IyPG~G~~~Vr~~~~~Dgkv~~F~~sKc~~~~~   45 (125)
T PTZ00033          4 IACEFSHFAVHPGHGRRYVPFAFLSTKPVLTFLRPKCFALYM   45 (125)
T ss_pred             eEecCcCCcccCCCCcEeeecccCCCCCEEEEecHHHHHHHH
Confidence            47999999999998765556    55   3599999965444


No 32 
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain. Collybistin pleckstrin homology (PH) domain. Collybistin is GEF which induces submembrane clustering of the receptor-associated peripheral membrane protein gephyrin.  It consists of an SH3 domain, followed by a RhoGEF(dbH) and PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=23.89  E-value=37  Score=26.76  Aligned_cols=21  Identities=38%  Similarity=0.754  Sum_probs=15.6

Q ss_pred             hccccccCCCCCCCceeEEcCC
Q 030117           94 RTCGLCKRRLVPGRDIYMYRGD  115 (182)
Q Consensus        94 ~~C~lCkK~L~~gkDIYMYRGe  115 (182)
                      ..--+|||.+.. +|.|.|+|-
T Consensus        28 ~~LI~CKkd~~r-~~~~~yKgr   48 (109)
T cd01224          28 HQMVLCKKDLIR-RDHLYYKGR   48 (109)
T ss_pred             ceEEEEeccccc-CCcEEEEEE
Confidence            344569999854 689999973


No 33 
>PF08600 Rsm1:  Rsm1-like;  InterPro: IPR013909 This entry contains Nuclear-interacting partner of ALK (NIPA) and NIPA like proteins, as well as mRNA export factor Rsm1, all of which contain a C3HC-type zinc finger. The domain represented in this entry is found C-terminal to the zinc-finger like domain IPR012935 from INTERPRO. Rsm1 is involved in mRNA export from the nucleus []. NIPA is an essential component of an SCF-type E3 ligase complex, SCF(NIPA), a complex that controls mitotic entry by mediating ubiquitination and subsequent degradation of cyclin B1 (CCNB1). Its cell-cycle-dependent phosphorylation regulates the assembly of the SCF(NIPA) complex, restricting CCNB1 ubiquitination activity to interphase. Its inactivation results in nuclear accumulation of CCNB1 in interphase and premature mitotic entry [].
Probab=21.82  E-value=34  Score=25.40  Aligned_cols=17  Identities=41%  Similarity=1.028  Sum_probs=15.3

Q ss_pred             hhccccccCCCCCCCceeEEc
Q 030117           93 LRTCGLCKRRLVPGRDIYMYR  113 (182)
Q Consensus        93 L~~C~lCkK~L~~gkDIYMYR  113 (182)
                      |-.|..|.|+|+    ++||+
T Consensus        19 ~~~C~~C~Rr~G----LW~f~   35 (91)
T PF08600_consen   19 LLSCSYCFRRLG----LWMFK   35 (91)
T ss_pred             eEEccccCcEee----eeecc
Confidence            889999999994    89997


Done!