Citrus Sinensis ID: 030155


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MANQRPTKTLFVINFDPIRTRERDIKRHFEPYGNVLHVRIRRNFAFVQFETQEEATKALESTDRSKLVDRVISVEYALKDDSERDDRYDSPRRGGYGRHSPYGRSPSPAYRRRPSPDYGRGRSPAYDRYNGPVYDQRRSPDHGRHRSPVPVYDRRRSPDYGRNRSPNFGRYRSRSPVRRSRT
ccccccccEEEEEccccccccHHHHHHHHcccccEEEEEEcccEEEEEEccHHHHHHHHHHHcccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*****PT*TLFVINFDPIRTRERDIKRHFEPYGNVLHVRIRRNFAFVQFETQEEATKALESTDRSKLVDRVISVEY**********************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANQRPTKTLFVINFDPIRTRERDIKRHFEPYGNVLHVRIRRNFAFVQFETQEEATKALESTDRSKLVDRVISVEYALKDDSERDDRYDSPRRGGYGRHSPYGRSPSPAYRRRPSPDYGRGRSPAYDRYNGPVYDQRRSPDHGRHRSPVPVYDRRRSPDYGRNRSPNFGRYRSRSPVRRSRT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Arginine/serine-rich-splicing factor RSP31 Required for constitutive and alternative pre-mRNA splicing.probableP92964

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SMZ, chain A
Confidence level:very confident
Coverage over the Query: 4-82
View the alignment between query and template
View the model in PyMOL