Citrus Sinensis ID: 030156


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MGIMFSRMFSSLFGNKEARILVLGLDNAGKTTILYRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRCYFPNTEAVIYVVDSSDTDRIQTAKEEFHAILEEEELKGAVALIFANKQDLPGALDDAAVSEALELHKIKNRQWAIFKTCAIKGEGLFEGMDWLSNTLKSGGS
cccHHHHHHHccccccEEEEEEEEcccccHHHHHHHHHcccEEEEcccccEEEEEEEEccEEEEEEECccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHHcccc
*GIMFSRMFSSLFGNKEARILVLGLDNAGKTTILYRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRCYFPNTEAVIYVVDSSDTDRIQTAKEEFHAILEEEELKGAVALIFANKQDLPGALDDAAVSEALELHKIKNRQWAIFKTCAIKGEGLFEGMDWLS*TLK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGIMFSRMFSSLFGNKEARILVLGLDNAGKTTILYRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRCYFPNTEAVIYVVDSSDTDRIQTAKEEFHAILEEEELKGAVALIFANKQDLPGALDDAAVSEALELHKIKNRQWAIFKTCAIKGEGLFEGMDWLSNTLKSGGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ADP-ribosylation factor 3 GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.confidentP40940
ADP-ribosylation factor 1 GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.confidentQ96361
ADP-ribosylation factor 2 GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.probableP84082

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MOZ, chain A
Confidence level:very confident
Coverage over the Query: 2-180
View the alignment between query and template
View the model in PyMOL