Citrus Sinensis ID: 030171


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MEVRPNPTVENLRATAAASSKQPVSSPNTVDTTSVTQRLQKELMSLMMSGGDLGVSAFPEGESIFTWIGTIEGGKGTMYEGLSYKLSLRFPLDYPFKPPQVKFETMCFHPNVDQYGNICLDILQDKWSSAYDCRTILLSIQSLLGEPNPESPLNSYAAALLNNKEDYRKMVQKQYFAGEFES
cccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccEEEEcccccEEEEEEEEccccccccccEEEEEEEccccccccccEEEECcccccccccccccEEEEccccccccHccHHHHHHHHHHHccccccccccHHHHHHHHccHHHHHHHHHHHHHHccccc
*****************************************ELMSLMMSGGDLGVSAFPEGESIFTWIGTIEGGKGTMYEGLSYKLSLRFPLDYPFKPPQVKFETMCFHPNVDQYGNICLDILQDKWSSAYDCRTILLSIQSLLGEPNPESPLNSYAAALLNNKEDYRKMVQKQY*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVRPNPTVENLRATAAASSKQPVSSPNTVDTTSVTQRLQKELMSLMMSGGDLGVSAFPEGESIFTWIGTIEGGKGTMYEGLSYKLSLRFPLDYPFKPPQVKFETMCFHPNVDQYGNICLDILQDKWSSAYDCRTILLSIQSLLGEPNPESPLNSYAAALLNNKEDYRKMVQKQYFAGEFES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-conjugating enzyme E2-20 kDa Catalyzes the covalent attachment of ubiquitin to other proteins.probableO00103
Ubiquitin-conjugating enzyme E2 C Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.probableO00762
Ubiquitin-conjugating enzyme E2 C Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.probableQ32PA5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I7K, chain A
Confidence level:very confident
Coverage over the Query: 34-180
View the alignment between query and template
View the model in PyMOL
Template: 2HLW, chain A
Confidence level:very confident
Coverage over the Query: 6-158
View the alignment between query and template
View the model in PyMOL