Query         030194
Match_columns 181
No_of_seqs    14 out of 16
Neff          2.3 
Searched_HMMs 46136
Date          Fri Mar 29 10:00:22 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030194.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030194hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK12819 flgG flagellar basal   55.6      13 0.00029   31.5   3.2   40   39-82    153-192 (257)
  2 PRK12818 flgG flagellar basal   46.4      41 0.00089   28.7   4.7   22   60-81    172-193 (256)
  3 PF08208 RNA_polI_A34:  DNA-dir  44.6      43 0.00094   27.0   4.4   48   24-71     39-95  (198)
  4 KOG2131 Uncharacterized conser  44.2      11 0.00024   35.8   1.1   29   37-66    271-299 (427)
  5 PRK12694 flgG flagellar basal   43.7      28 0.00061   29.6   3.3   22   61-82    172-193 (260)
  6 TIGR02490 flgF flagellar basal  41.8      40 0.00087   24.1   3.4   21   61-81     26-46  (89)
  7 PRK12691 flgG flagellar basal   41.5      31 0.00068   29.2   3.3   22   61-82    172-193 (262)
  8 PRK12693 flgG flagellar basal   41.3      31 0.00066   29.1   3.2   22   61-82    172-193 (261)
  9 TIGR02488 flgG_G_neg flagellar  40.9      33 0.00072   29.0   3.4   22   61-82    170-191 (259)
 10 PRK12692 flgG flagellar basal   40.4      34 0.00073   29.3   3.4   22   61-82    172-193 (262)
 11 COG3338 Cah Carbonic anhydrase  38.9      35 0.00076   30.6   3.3   36    4-42     85-120 (250)
 12 PRK12636 flgG flagellar basal   35.6      41 0.00089   28.6   3.1   22   61-82    173-194 (263)
 13 PRK12817 flgG flagellar basal   32.2      54  0.0012   27.9   3.3   21   61-81    176-196 (260)
 14 PF04225 OapA:  Opacity-associa  32.0      33 0.00072   24.9   1.7   19    5-23     45-63  (85)
 15 TIGR03506 FlgEFG_subfam fagell  31.9      51  0.0011   27.3   3.1   21   61-81    160-180 (231)
 16 PRK12689 flgF flagellar basal   30.0      62  0.0013   27.7   3.3   20   62-81    167-186 (253)
 17 PF08661 Rep_fac-A_3:  Replicat  29.6      64  0.0014   23.8   3.0   29    1-29     13-46  (109)
 18 PTZ00363 rab-GDP dissociation   28.3 1.2E+02  0.0026   27.9   5.1   22   52-73    293-314 (443)
 19 TIGR02489 flgE_epsilon flagell  28.0      72  0.0016   31.9   3.8   40   39-82    610-650 (719)
 20 PRK12816 flgG flagellar basal   25.6      82  0.0018   27.0   3.3   22   61-82    174-195 (264)
 21 KOG0537 Cytochrome b5 [Energy   25.5      33 0.00071   26.9   0.8   23   26-48     26-49  (124)
 22 PF13103 TonB_2:  TonB C termin  24.2      55  0.0012   22.1   1.6   21    8-28     29-51  (85)
 23 PF12392 DUF3656:  Collagenase   22.1 1.4E+02  0.0031   22.1   3.7   43    5-48     34-100 (122)
 24 PF09936 Methyltrn_RNA_4:  SAM-  22.0      45 0.00097   28.6   1.0   12   61-72      5-16  (185)
 25 PF02373 JmjC:  JmjC domain, hy  20.3      50  0.0011   22.9   0.8   14   37-50     84-97  (114)
 26 PRK12690 flgF flagellar basal   20.2 1.2E+02  0.0026   25.8   3.3   21   61-81    155-175 (238)

No 1  
>PRK12819 flgG flagellar basal body rod protein FlgG; Reviewed
Probab=55.55  E-value=13  Score=31.52  Aligned_cols=40  Identities=5%  Similarity=0.148  Sum_probs=26.3

Q ss_pred             CCCceEEecCCCCCcccceeeeeEEeeecCCchhhhccCCcccc
Q 030194           39 EPDEMVFLNYPSEPKIVGKISRRVSLVHYPEPKEVEELNPDKIR   82 (181)
Q Consensus        39 ~pDatVfl~S~se~kivGKISRRVslV~YPeP~Elek~~~~~~~   82 (181)
                      ++|-+|+.-...  ..||+|  +|.||.+|+|..|++..-+-.+
T Consensus       153 ~~dG~I~~~~~~--~~vg~l--~l~~v~~~~~~~L~~~g~~lf~  192 (257)
T PRK12819        153 QADGTLYDAVTQ--NNIARL--QTKTVSAEQNDRLVQRENKSFT  192 (257)
T ss_pred             cCCCEEEEEeCC--ceEEEE--EEEEeCCCCHHHCeECCCCeEe
Confidence            356666552111  247777  6677999999999996655443


No 2  
>PRK12818 flgG flagellar basal body rod protein FlgG; Reviewed
Probab=46.44  E-value=41  Score=28.67  Aligned_cols=22  Identities=0%  Similarity=0.230  Sum_probs=17.3

Q ss_pred             eeEEeeecCCchhhhccCCccc
Q 030194           60 RRVSLVHYPEPKEVEELNPDKI   81 (181)
Q Consensus        60 RRVslV~YPeP~Elek~~~~~~   81 (181)
                      -++.||.+++|..|++...+-.
T Consensus       172 g~l~lv~~~~p~~L~~~g~~lf  193 (256)
T PRK12818        172 YKFNVADFNDYNSLKKIGDNLY  193 (256)
T ss_pred             EEEEEEecCChHHCeecCCCcc
Confidence            3578999999999999665444


No 3  
>PF08208 RNA_polI_A34:  DNA-directed RNA polymerase I subunit RPA34.5;  InterPro: IPR013240 This is a family of proteins conserved from yeasts to human. Subunit A34.5 of RNA polymerase I is a non-essential subunit which is thought to help Pol I overcome topological constraints imposed on ribosomal DNA during the process of transcription [].; PDB: 3NFG_N.
Probab=44.60  E-value=43  Score=26.98  Aligned_cols=48  Identities=15%  Similarity=0.241  Sum_probs=27.3

Q ss_pred             CCCCceeeeeeec---cCCCCceEEecCCCCCc-c--cceeeeeEEee---ecCCch
Q 030194           24 DSSGKAYDIVSND---FQEPDEMVFLNYPSEPK-I--VGKISRRVSLV---HYPEPK   71 (181)
Q Consensus        24 ~SsGk~YdlvSfa---aQ~pDatVfl~S~se~k-i--vGKISRRVslV---~YPeP~   71 (181)
                      .-+|..|.|..-.   ...-..+||||+..... .  -=.|.|-+.|.   ..|...
T Consensus        39 ~~~~~~Y~i~~~~~~~~~~~~~~lL~p~~~~~~~~~~~~~~~~~~~I~e~~~ip~~~   95 (198)
T PF08208_consen   39 KHKGKDYQISEDSINQEESSSISLLLPSKKGGGYLVASKPFDRFLHISEIVQIPQID   95 (198)
T ss_dssp             EETTEEEEEEEGGGSGS--TTEEEEEE-SSSTTEEESB---SEEEEEEE--------
T ss_pred             eeCCceEEEEecccCccccCCeEEEeEcCCCCceeccCCCcceEEEEEEecCCCCcc
Confidence            5679999999876   45778899999966654 2  34677777765   555555


No 4  
>KOG2131 consensus Uncharacterized conserved protein, contains JmjC domain [Chromatin structure and dynamics; Signal transduction mechanisms]
Probab=44.24  E-value=11  Score=35.79  Aligned_cols=29  Identities=34%  Similarity=0.464  Sum_probs=23.7

Q ss_pred             cCCCCceEEecCCCCCcccceeeeeEEeee
Q 030194           37 FQEPDEMVFLNYPSEPKIVGKISRRVSLVH   66 (181)
Q Consensus        37 aQ~pDatVfl~S~se~kivGKISRRVslV~   66 (181)
                      .|+|.+|||+||+=-- -|=+|...+||-|
T Consensus       271 ~Qepge~VFvPsGW~h-QV~NL~dTISINH  299 (427)
T KOG2131|consen  271 FQEPGETVFVPSGWHH-QVLNLGDTISINH  299 (427)
T ss_pred             hccCCceeeccCcccc-ccccccceeeecc
Confidence            6999999999996443 3778888888876


No 5  
>PRK12694 flgG flagellar basal body rod protein FlgG; Reviewed
Probab=43.72  E-value=28  Score=29.59  Aligned_cols=22  Identities=9%  Similarity=0.288  Sum_probs=17.3

Q ss_pred             eEEeeecCCchhhhccCCcccc
Q 030194           61 RVSLVHYPEPKEVEELNPDKIR   82 (181)
Q Consensus        61 RVslV~YPeP~Elek~~~~~~~   82 (181)
                      ++.||.|++|..|++...+-.+
T Consensus       172 ~l~lv~~~~~~~L~~~G~~lf~  193 (260)
T PRK12694        172 QLQLATFINPAGLQAKGENLFA  193 (260)
T ss_pred             eeEEEecCChHhCeEcCCCceE
Confidence            4679999999999997655443


No 6  
>TIGR02490 flgF flagellar basal-body rod protein FlgF. Members of this protein are FlgF, one of several homologous flagellar basal-body rod proteins in bacteria.
Probab=41.80  E-value=40  Score=24.10  Aligned_cols=21  Identities=19%  Similarity=0.488  Sum_probs=16.7

Q ss_pred             eEEeeecCCchhhhccCCccc
Q 030194           61 RVSLVHYPEPKEVEELNPDKI   81 (181)
Q Consensus        61 RVslV~YPeP~Elek~~~~~~   81 (181)
                      ++.||+|++|+.|++..-+-.
T Consensus        26 ~l~l~~f~~~~~L~~~g~~~~   46 (89)
T TIGR02490        26 RLGLVNFDNPNQLQREGDGLF   46 (89)
T ss_pred             EEEEEecCCHHHceEcCCCeE
Confidence            478999999999998655444


No 7  
>PRK12691 flgG flagellar basal body rod protein FlgG; Reviewed
Probab=41.54  E-value=31  Score=29.18  Aligned_cols=22  Identities=14%  Similarity=0.439  Sum_probs=17.3

Q ss_pred             eEEeeecCCchhhhccCCcccc
Q 030194           61 RVSLVHYPEPKEVEELNPDKIR   82 (181)
Q Consensus        61 RVslV~YPeP~Elek~~~~~~~   82 (181)
                      ++.||.|++|..|++..-+-.+
T Consensus       172 ~l~lv~~~~~~~L~~~g~~lf~  193 (262)
T PRK12691        172 QITLARFTNEAGLEAIGDNLFR  193 (262)
T ss_pred             eeEEEecCChHHCeECCCCeEE
Confidence            4579999999999987655543


No 8  
>PRK12693 flgG flagellar basal body rod protein FlgG; Provisional
Probab=41.32  E-value=31  Score=29.08  Aligned_cols=22  Identities=14%  Similarity=0.392  Sum_probs=17.0

Q ss_pred             eEEeeecCCchhhhccCCcccc
Q 030194           61 RVSLVHYPEPKEVEELNPDKIR   82 (181)
Q Consensus        61 RVslV~YPeP~Elek~~~~~~~   82 (181)
                      ++.||.|++|..|++..-+-.+
T Consensus       172 ~l~~~~~~~~~~L~~~g~~lf~  193 (261)
T PRK12693        172 QITLTDFINPAGLESIGENLYL  193 (261)
T ss_pred             ceeEEecCChHHceECCCceEE
Confidence            3679999999999996655443


No 9  
>TIGR02488 flgG_G_neg flagellar basal-body rod protein FlgG, Gram-negative bacteria. This family consists of the FlgG protein of the flagellar apparatus in the Proteobacteria and spirochetes.
Probab=40.95  E-value=33  Score=28.99  Aligned_cols=22  Identities=18%  Similarity=0.495  Sum_probs=17.3

Q ss_pred             eEEeeecCCchhhhccCCcccc
Q 030194           61 RVSLVHYPEPKEVEELNPDKIR   82 (181)
Q Consensus        61 RVslV~YPeP~Elek~~~~~~~   82 (181)
                      |+.||.|++|++|++..-+-.+
T Consensus       170 ~l~lv~~~~~~~L~~~g~~lf~  191 (259)
T TIGR02488       170 QITLATFINPAGLEAVGENLFR  191 (259)
T ss_pred             eEEEEecCCHHHCeEcCCCcEE
Confidence            4679999999999996655443


No 10 
>PRK12692 flgG flagellar basal body rod protein FlgG; Reviewed
Probab=40.45  E-value=34  Score=29.33  Aligned_cols=22  Identities=18%  Similarity=0.389  Sum_probs=17.0

Q ss_pred             eEEeeecCCchhhhccCCcccc
Q 030194           61 RVSLVHYPEPKEVEELNPDKIR   82 (181)
Q Consensus        61 RVslV~YPeP~Elek~~~~~~~   82 (181)
                      ++.||.+++|..|++..-+-.+
T Consensus       172 ~l~lv~~~~~~~L~~~g~~lf~  193 (262)
T PRK12692        172 QLTLANFANESGLEPLGNGLYR  193 (262)
T ss_pred             eEEEEecCChHHCeEcCCccEe
Confidence            4669999999999986655443


No 11 
>COG3338 Cah Carbonic anhydrase [Inorganic ion transport and metabolism]
Probab=38.85  E-value=35  Score=30.60  Aligned_cols=36  Identities=22%  Similarity=0.516  Sum_probs=27.8

Q ss_pred             CCCceeEEEecCCCccccccCCCCceeeeeeeccCCCCc
Q 030194            4 FDGKELSLELRGNGRLGSFEDSSGKAYDIVSNDFQEPDE   42 (181)
Q Consensus         4 f~g~elsl~l~~DG~lgsfe~SsGk~YdlvSfaaQ~pDa   42 (181)
                      +||.+|.+....++++=.|   +||.|+||.|.+--|-+
T Consensus        85 nnghTiqv~~~~~~n~l~~---~gk~y~L~qfHFH~PsE  120 (250)
T COG3338          85 NNGHTIQVNFEPGSNHLRY---DGKTYQLVQFHFHAPSE  120 (250)
T ss_pred             ecCcEEEEeccCCCcceee---cCcEEEEEEEEecCchH
Confidence            5788888888876555543   69999999999876643


No 12 
>PRK12636 flgG flagellar basal body rod protein FlgG; Provisional
Probab=35.56  E-value=41  Score=28.63  Aligned_cols=22  Identities=18%  Similarity=0.480  Sum_probs=17.9

Q ss_pred             eEEeeecCCchhhhccCCcccc
Q 030194           61 RVSLVHYPEPKEVEELNPDKIR   82 (181)
Q Consensus        61 RVslV~YPeP~Elek~~~~~~~   82 (181)
                      ++.||.|++|.+|++...+-.+
T Consensus       173 ~l~lv~f~~~~~L~~~g~~lf~  194 (263)
T PRK12636        173 QIGLATFANPDGLEKAGDNLYR  194 (263)
T ss_pred             EEEEEecCChHhCeEcCCceEE
Confidence            6789999999999997665544


No 13 
>PRK12817 flgG flagellar basal body rod protein FlgG; Reviewed
Probab=32.23  E-value=54  Score=27.89  Aligned_cols=21  Identities=0%  Similarity=0.064  Sum_probs=16.8

Q ss_pred             eEEeeecCCchhhhccCCccc
Q 030194           61 RVSLVHYPEPKEVEELNPDKI   81 (181)
Q Consensus        61 RVslV~YPeP~Elek~~~~~~   81 (181)
                      ++.||.+++|..|++..-+-.
T Consensus       176 ~l~lv~~~~~~~L~~~g~~lf  196 (260)
T PRK12817        176 KINIYNAVGNDAFISIGDNLY  196 (260)
T ss_pred             EEEEEeccChHHceecCCceE
Confidence            578999999999998665444


No 14 
>PF04225 OapA:  Opacity-associated protein A LysM-like domain;  InterPro: IPR007340 This entry includes the Haemophilus influenzae opacity-associated protein. This protein is required for efficient nasopharyngeal mucosal colonization, and its expression is associated with a distinctive transparent colony phenotype. OapA is thought to be a secreted protein, and its expression exhibits high-frequency phase variation [].; PDB: 2GU1_A.
Probab=31.96  E-value=33  Score=24.94  Aligned_cols=19  Identities=26%  Similarity=0.611  Sum_probs=13.9

Q ss_pred             CCceeEEEecCCCcccccc
Q 030194            5 DGKELSLELRGNGRLGSFE   23 (181)
Q Consensus         5 ~g~elsl~l~~DG~lgsfe   23 (181)
                      -|++|.+.++.||.|..+.
T Consensus        45 pGq~l~f~~d~~g~L~~L~   63 (85)
T PF04225_consen   45 PGQTLEFQLDEDGQLTALR   63 (85)
T ss_dssp             TT-EEEEEE-TTS-EEEEE
T ss_pred             CCCEEEEEECCCCCEEEEE
Confidence            4999999999999998765


No 15 
>TIGR03506 FlgEFG_subfam fagellar hook-basal body proteins. This model encompasses three closely related flagellar proteins usually denoted FlgE, FlgF and FlgG. The names have often been mis-assigned, however. Three equivalog models, TIGR02489, TIGR02490 and TIGR00488, respectively, separate the individual forms into three genome-context consistent groups. The major differences between these genes are architectural, with variable central sections between relatively conserved N- and C-terminal domains. More distantly related are two other flagellar apparatus familis, FlgC (TIGR01395) which consists of little else but the N-and C-terminal domains and FlgK (TIGR02492) with a substantial but different central domain.
Probab=31.89  E-value=51  Score=27.34  Aligned_cols=21  Identities=14%  Similarity=0.488  Sum_probs=17.1

Q ss_pred             eEEeeecCCchhhhccCCccc
Q 030194           61 RVSLVHYPEPKEVEELNPDKI   81 (181)
Q Consensus        61 RVslV~YPeP~Elek~~~~~~   81 (181)
                      ++.||.+++|+.|++..-+-.
T Consensus       160 ~l~l~~~~~~~~L~~~g~~lf  180 (231)
T TIGR03506       160 QIALANFPNPDGLRKEGGNLY  180 (231)
T ss_pred             eEeEEecCCHHHceEcCCceE
Confidence            688999999999998665443


No 16 
>PRK12689 flgF flagellar basal body rod protein FlgF; Reviewed
Probab=29.96  E-value=62  Score=27.67  Aligned_cols=20  Identities=15%  Similarity=0.428  Sum_probs=16.0

Q ss_pred             EEeeecCCchhhhccCCccc
Q 030194           62 VSLVHYPEPKEVEELNPDKI   81 (181)
Q Consensus        62 VslV~YPeP~Elek~~~~~~   81 (181)
                      +.||.+++|.+|++..-+-.
T Consensus       167 i~lv~~~~~~~L~~~g~~lf  186 (253)
T PRK12689        167 LRLVTFANPQALKKEGANLY  186 (253)
T ss_pred             EEEEecCChHHCeEcCCCcE
Confidence            57999999999999665443


No 17 
>PF08661 Rep_fac-A_3:  Replication factor A protein 3;  InterPro: IPR013970  Replication factor A is involved in eukaryotic DNA replication, recombination and repair. ; PDB: 2PI2_H 1L1O_D 3KDF_A 2Z6K_D 1QUQ_D 2PQA_D.
Probab=29.63  E-value=64  Score=23.81  Aligned_cols=29  Identities=21%  Similarity=0.464  Sum_probs=18.0

Q ss_pred             CCCCCCceeEE-----EecCCCccccccCCCCce
Q 030194            1 MPDFDGKELSL-----ELRGNGRLGSFEDSSGKA   29 (181)
Q Consensus         1 l~Df~g~elsl-----~l~~DG~lgsfe~SsGk~   29 (181)
                      |+.|.|+.+.|     .++.+|....++.++|+.
T Consensus        13 L~~~~gk~VrivGkv~~~~~~g~~~~l~~~d~~~   46 (109)
T PF08661_consen   13 LSQFVGKTVRIVGKVESVDPDGGSATLSTSDGGQ   46 (109)
T ss_dssp             GGGGTTSEEEEEEEEEEE-TTSSEEEEE-TTS-E
T ss_pred             HHhhCCCeEEEEEEEeeEcCCCCEEEEEcCCCCE
Confidence            45678888776     355667777777777763


No 18 
>PTZ00363 rab-GDP dissociation inhibitor; Provisional
Probab=28.31  E-value=1.2e+02  Score=27.92  Aligned_cols=22  Identities=32%  Similarity=0.517  Sum_probs=18.3

Q ss_pred             CcccceeeeeEEeeecCCchhh
Q 030194           52 PKIVGKISRRVSLVHYPEPKEV   73 (181)
Q Consensus        52 ~kivGKISRRVslV~YPeP~El   73 (181)
                      .+.+|+|.|.|||+.=|-|+-.
T Consensus       293 ~~~~~~v~R~i~i~~~pi~~~~  314 (443)
T PTZ00363        293 VKKVGKVIRCICILNHPIPNTN  314 (443)
T ss_pred             cccccEEEEEEEEEcccccccC
Confidence            3469999999999998887743


No 19 
>TIGR02489 flgE_epsilon flagellar hook protein FlgE, epsilon proteobacterial. Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the Proteobacteria (Helicobacter, Wolinella, and Campylobacter). These proteins differ significantly in architecture from proteins designated FlgE in other lineages; the N-terminal and C-terminal domains are homologous, but members of this family only contain a large central domain that is surface-exposed and variable between strains.
Probab=28.04  E-value=72  Score=31.91  Aligned_cols=40  Identities=3%  Similarity=0.184  Sum_probs=25.4

Q ss_pred             CCCceEEecCC-CCCcccceeeeeEEeeecCCchhhhccCCcccc
Q 030194           39 EPDEMVFLNYP-SEPKIVGKISRRVSLVHYPEPKEVEELNPDKIR   82 (181)
Q Consensus        39 ~pDatVfl~S~-se~kivGKISRRVslV~YPeP~Elek~~~~~~~   82 (181)
                      ++|-+|+.... .+..+||    +|+||+|++|++|++..-.-.+
T Consensus       610 d~dG~I~g~ysNG~~~~lg----qIala~F~np~gL~~~G~nl~~  650 (719)
T TIGR02489       610 DSNGNLLGEFSNGKTFALA----QVAMASFANNSGLQAEGGNLFS  650 (719)
T ss_pred             CCCCEEEEEEeCCceEEEE----EEEEEecCChHHheEcCCceEE
Confidence            45666653221 2333455    5789999999999997654443


No 20 
>PRK12816 flgG flagellar basal body rod protein FlgG; Reviewed
Probab=25.61  E-value=82  Score=27.04  Aligned_cols=22  Identities=9%  Similarity=0.415  Sum_probs=17.1

Q ss_pred             eEEeeecCCchhhhccCCcccc
Q 030194           61 RVSLVHYPEPKEVEELNPDKIR   82 (181)
Q Consensus        61 RVslV~YPeP~Elek~~~~~~~   82 (181)
                      ++.||.|++|..|++..-+-.+
T Consensus       174 ~l~lv~~~~~~~L~~~g~~lf~  195 (264)
T PRK12816        174 QIELYRFVNPAGLSAIGKNLFK  195 (264)
T ss_pred             eEEEEeccChHHceEcCCCcEE
Confidence            4679999999999986655443


No 21 
>KOG0537 consensus Cytochrome b5 [Energy production and conversion]
Probab=25.55  E-value=33  Score=26.89  Aligned_cols=23  Identities=39%  Similarity=0.580  Sum_probs=17.9

Q ss_pred             CCceeeeeeeccCCCCc-eEEecC
Q 030194           26 SGKAYDIVSNDFQEPDE-MVFLNY   48 (181)
Q Consensus        26 sGk~YdlvSfaaQ~pDa-tVfl~S   48 (181)
                      .|++||+-.|.-.-|+- .|++-.
T Consensus        26 ~gkVYDvT~Fl~eHPGG~~vLl~~   49 (124)
T KOG0537|consen   26 HGKVYDVTSFLDEHPGGEDVLLEY   49 (124)
T ss_pred             CCEEEeccchhhhCCChHHHHHHH
Confidence            58999999999988875 455444


No 22 
>PF13103 TonB_2:  TonB C terminal; PDB: 1LR0_A.
Probab=24.17  E-value=55  Score=22.15  Aligned_cols=21  Identities=24%  Similarity=0.431  Sum_probs=12.7

Q ss_pred             eeEEEecCCCccc--cccCCCCc
Q 030194            8 ELSLELRGNGRLG--SFEDSSGK   28 (181)
Q Consensus         8 elsl~l~~DG~lg--sfe~SsGk   28 (181)
                      +|.|.|+.||.+-  .+..+||-
T Consensus        29 ~V~i~i~~dG~v~~~~i~~sSG~   51 (85)
T PF13103_consen   29 TVRITIDPDGRVISVRIVKSSGN   51 (85)
T ss_dssp             EEEEEE-TTSBEEEEEEEE--S-
T ss_pred             EEEEEECCCCCEEEEEEecCCCC
Confidence            5789999999983  44555554


No 23 
>PF12392 DUF3656:  Collagenase ;  InterPro: IPR020988 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.   The peptidases families associated with clan U- have an unknown catalytic mechanism as the protein fold of the active site domain and the active site residues have not been reported. This domain is found in a number of proteins belonging to the MEROPS peptidase family U32. Peptidase family U32 contains endopeptidases, including collagenase, from bacteria. 
Probab=22.09  E-value=1.4e+02  Score=22.10  Aligned_cols=43  Identities=21%  Similarity=0.370  Sum_probs=30.8

Q ss_pred             CCceeEEEec-CCCccccccCCC-----------------------CceeeeeeeccCCCCceEEecC
Q 030194            5 DGKELSLELR-GNGRLGSFEDSS-----------------------GKAYDIVSNDFQEPDEMVFLNY   48 (181)
Q Consensus         5 ~g~elsl~l~-~DG~lgsfe~Ss-----------------------Gk~YdlvSfaaQ~pDatVfl~S   48 (181)
                      .|+.+.|++. .||.-...+...                       |-.|++..+... -|..+|||-
T Consensus        34 ~g~p~~l~~~d~~~~~v~~~~~~~~e~A~~~p~~~e~i~~ql~KlG~T~F~~~~i~i~-~~~~lFlP~  100 (122)
T PF12392_consen   34 KGEPLKLTLSDEDGNSVEVTSEIVPEPAKKRPLDEERIRKQLSKLGNTPFELENIEID-LDEGLFLPI  100 (122)
T ss_pred             cCCCEEEEEEECCCcEEEEEecCCchhhCCCccCHHHHHHHHHhhCCCcEEEEEEEEE-cCCCEEEEH
Confidence            3677777777 777666544322                       557888888887 788899985


No 24 
>PF09936 Methyltrn_RNA_4:  SAM-dependent RNA methyltransferase;  InterPro: IPR019230  This entry contains proteins that have no known function. They are found as separate proteins and as a C-terminal domain to tRNA (guanine-N(1)-)-methyltransferases to which they are structurally related. ; PDB: 3DCM_X.
Probab=22.02  E-value=45  Score=28.62  Aligned_cols=12  Identities=42%  Similarity=0.783  Sum_probs=7.5

Q ss_pred             eEEeeecCCchh
Q 030194           61 RVSLVHYPEPKE   72 (181)
Q Consensus        61 RVslV~YPeP~E   72 (181)
                      -|+|||||--+.
T Consensus         5 yiaLvHyPV~nk   16 (185)
T PF09936_consen    5 YIALVHYPVYNK   16 (185)
T ss_dssp             EEEEE-SSEE-T
T ss_pred             EEEEeecccccC
Confidence            379999996543


No 25 
>PF02373 JmjC:  JmjC domain, hydroxylase;  InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [].There is evidence of domain swapping within the jumonji family of transcription factors []. This domain is often associated with jmjN (see IPR003349 from INTERPRO) and belongs to the Cupin superfamily [].; PDB: 2YU2_A 2YU1_A 3AVR_A 3AVS_A 2OX0_B 2OQ6_B 2WWJ_A 2Q8D_A 3PDQ_A 2YBK_A ....
Probab=20.25  E-value=50  Score=22.92  Aligned_cols=14  Identities=36%  Similarity=0.610  Sum_probs=9.8

Q ss_pred             cCCCCceEEecCCC
Q 030194           37 FQEPDEMVFLNYPS   50 (181)
Q Consensus        37 aQ~pDatVfl~S~s   50 (181)
                      -|+|.++||+|.+.
T Consensus        84 ~Q~~Ge~V~i~pg~   97 (114)
T PF02373_consen   84 VQKPGEFVFIPPGA   97 (114)
T ss_dssp             EEETT-EEEE-TT-
T ss_pred             eECCCCEEEECCCc
Confidence            59999999999864


No 26 
>PRK12690 flgF flagellar basal body rod protein FlgF; Reviewed
Probab=20.20  E-value=1.2e+02  Score=25.81  Aligned_cols=21  Identities=10%  Similarity=0.252  Sum_probs=16.7

Q ss_pred             eEEeeecCCchhhhccCCccc
Q 030194           61 RVSLVHYPEPKEVEELNPDKI   81 (181)
Q Consensus        61 RVslV~YPeP~Elek~~~~~~   81 (181)
                      ++.||.+++|.+|++..-+-.
T Consensus       155 ~l~lv~~~~~~~L~~~g~~lf  175 (238)
T PRK12690        155 QIGLYQPTDPLGLRREGGTRF  175 (238)
T ss_pred             eEEEEecCCHHHCeECCCCcE
Confidence            467999999999999665444


Done!