Citrus Sinensis ID: 030222

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
MATVLECVAVPRASASSVFSSPAKLSSSSINSISGRRKFAEFKGLKVRPVRSFGSVSQGSSSSFRLRRGAQIVCEAQETAVEDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccEEEEcccHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHcccCEEEEEEccccccHHHHcccccccEEEEEEccEEEEEEEccccHHHHHHHHHHHc
**TVLECVAV*******************************************************LRRGAQIVCEAQETAVEDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATVLECVAVPRASASSVFSSPAKLSSSSINSISGRRKFAEFKGLKVRPVRSFGSVSQGSSSSFRLRRGAQIVCEAQETAVEDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFKNGEKKDTVIGAVPKSTLTTSIEKFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin M4, chloroplastic Thiol-disulfide oxidoreductase involved in the redox regulation of enzyme of the oxidative pentose phosphate pathway. Under reducing conditions, inhibits the glucose-6-phosphate dehydrogenase.probableQ9SEU6
Thioredoxin M-type, chloroplastic Participates in various redox reactions through the reversible oxidation of the active center dithiol to a disulfide. The M form is known to activate NADP-malate dehydrogenase.probableQ9XGS0
Thioredoxin M1, chloroplastic Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of chloroplastic enzymes.probableQ6H7E4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 76-181
View the alignment between query and template
View the model in PyMOL