Citrus Sinensis ID: 030225


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
MGTGKTSLVLRFVKGQFFDFQESTIGAAFFTQVLSLNEVTIKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITSMDSFERAKKWVQELQRQGNPNLIMFLVANKVDLEEKRKVKNEEGELYAQENGLSFLETSAKSAHNVNELFYEIAKRLAEVNPSRQTGMKLHTESHGGGRRGFCCS
cccccHHHHHHHcccccccccccccccEEEccEEEEccEEEEEEEEccccccccccccHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccc
MGTGKTSLVLRFVKGQFFDFQESTIGAAFFTQVLSLNEVTIKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITSMDSFERAKKWVQELQRQGNPNLIMFLVANKVDLEEKRKVKNEEGELYAQENGLSFLETSAKSAHNVNELFYEIAKRL****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTGKTSLVLRFVKGQFFDFQESTIGAAFFTQVLSLNEVTIKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITSMDSFERAKKWVQELQRQGNPNLIMFLVANKVDLEEKRKVKNEEGELYAQENGLSFLETSAKSAHNVNELFYEIAKRLAEVNPSRQTGMKLHTESHGGGRRGFCCS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein Rab-5C Protein transport. Probably involved in vesicular traffic.probableP51148
Ras-related protein Rab-5A Required for the fusion of plasma membranes and early endosomes.probableQ86JP3
Ras-related protein Rab-5B Protein transport. Probably involved in vesicular traffic.probableQ5ZHW4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CPJ, chain B
Confidence level:very confident
Coverage over the Query: 1-157
View the alignment between query and template
View the model in PyMOL
Template: 4DKX, chain A
Confidence level:very confident
Coverage over the Query: 1-18,29-153
View the alignment between query and template
View the model in PyMOL