Query         030241
Match_columns 181
No_of_seqs    135 out of 737
Neff          7.1 
Searched_HMMs 46136
Date          Fri Mar 29 10:44:03 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030241.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030241hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK00423 tfb transcription ini 100.0 6.9E-45 1.5E-49  310.4  15.2  163    3-167    11-199 (310)
  2 KOG1597 Transcription initiati 100.0 1.7E-42 3.6E-47  287.6  14.3  163    4-167     1-181 (308)
  3 COG1405 SUA7 Transcription ini 100.0 3.3E-37 7.2E-42  259.6  11.5  148    4-160     2-159 (285)
  4 KOG1598 Transcription initiati  99.8 4.9E-19 1.1E-23  157.5  10.0  121    4-160     1-128 (521)
  5 PF08271 TF_Zn_Ribbon:  TFIIB z  99.7 7.2E-18 1.6E-22  104.1   3.2   43    4-47      1-43  (43)
  6 PF00382 TFIIB:  Transcription   99.3 4.3E-12 9.3E-17   86.0   6.8   49  112-160     1-56  (71)
  7 PRK00423 tfb transcription ini  98.4 1.2E-06 2.6E-11   75.2   7.1   53  108-160   219-278 (310)
  8 cd00043 CYCLIN Cyclin box fold  98.0 4.1E-05 8.8E-10   51.5   7.4   54  107-160     4-64  (88)
  9 smart00385 CYCLIN domain prese  97.9 5.4E-05 1.2E-09   50.5   6.5   50  111-160     2-58  (83)
 10 COG1405 SUA7 Transcription ini  97.8 5.1E-05 1.1E-09   64.5   6.3   54  107-160   193-253 (285)
 11 KOG1597 Transcription initiati  97.3 0.00083 1.8E-08   57.0   6.6   53  108-160   203-262 (308)
 12 PF01857 RB_B:  Retinoblastoma-  97.3  0.0018 3.9E-08   49.3   7.9   57  104-160    10-75  (135)
 13 PF11781 RRN7:  RNA polymerase   97.1 0.00038 8.3E-09   41.1   2.2   28    4-34      9-36  (36)
 14 PF08792 A2L_zn_ribbon:  A2L zi  96.9 0.00084 1.8E-08   38.9   2.6   31    1-33      1-31  (33)
 15 PRK00415 rps27e 30S ribosomal   96.9 0.00055 1.2E-08   44.7   1.8   31    4-35     12-42  (59)
 16 COG2051 RPS27A Ribosomal prote  96.9 0.00058 1.3E-08   45.5   1.7   31    4-35     20-50  (67)
 17 PF01667 Ribosomal_S27e:  Ribos  96.8 0.00047   1E-08   44.5   0.9   30    4-34      8-37  (55)
 18 PHA00626 hypothetical protein   96.7  0.0014 3.1E-08   42.2   2.6   31    4-35      1-35  (59)
 19 TIGR00569 ccl1 cyclin ccl1. Un  96.7   0.007 1.5E-07   52.0   7.3   59  102-160    52-120 (305)
 20 PLN00209 ribosomal protein S27  96.3   0.002 4.4E-08   45.1   1.7   31    4-35     37-67  (86)
 21 PTZ00083 40S ribosomal protein  96.3  0.0024 5.3E-08   44.6   1.8   31    4-35     36-66  (85)
 22 COG5333 CCL1 Cdk activating ki  96.3  0.0046   1E-07   52.7   3.8   53  106-158    46-105 (297)
 23 PF13248 zf-ribbon_3:  zinc-rib  96.1  0.0031 6.7E-08   34.4   1.3   22    4-31      3-24  (26)
 24 PRK00398 rpoP DNA-directed RNA  96.0  0.0051 1.1E-07   38.0   2.2   31    1-33      1-31  (46)
 25 PRK00420 hypothetical protein;  96.0   0.005 1.1E-07   45.4   2.5   31    1-34     21-51  (112)
 26 PF13240 zinc_ribbon_2:  zinc-r  96.0  0.0033 7.1E-08   33.4   1.1   22    5-32      1-22  (23)
 27 PF14803 Nudix_N_2:  Nudix N-te  95.7  0.0064 1.4E-07   35.4   1.6   26    5-32      2-31  (34)
 28 COG1645 Uncharacterized Zn-fin  95.6  0.0057 1.2E-07   46.2   1.4   27    3-33     28-55  (131)
 29 PF02150 RNA_POL_M_15KD:  RNA p  95.6    0.01 2.3E-07   34.7   2.2   30    4-34      2-31  (35)
 30 PF08274 PhnA_Zn_Ribbon:  PhnA   95.5   0.011 2.5E-07   33.4   2.0   27    4-33      3-29  (30)
 31 KOG0834 CDK9 kinase-activating  95.4   0.032 6.9E-07   48.4   5.4   55  106-160    40-101 (323)
 32 PF00134 Cyclin_N:  Cyclin, N-t  95.4   0.055 1.2E-06   39.3   5.9   53  105-157    31-90  (127)
 33 PRK00432 30S ribosomal protein  95.2   0.013 2.9E-07   37.0   2.0   27    4-33     21-47  (50)
 34 PRK11827 hypothetical protein;  95.1   0.017 3.8E-07   37.9   2.3   28    4-33      9-36  (60)
 35 smart00778 Prim_Zn_Ribbon Zinc  94.9   0.025 5.4E-07   33.6   2.3   29    3-31      3-33  (37)
 36 COG1997 RPL43A Ribosomal prote  94.7    0.03 6.5E-07   39.4   2.7   29    3-33     35-63  (89)
 37 PF10571 UPF0547:  Uncharacteri  94.6   0.019   4E-07   31.4   1.1   24    5-34      2-25  (26)
 38 PRK10220 hypothetical protein;  94.4   0.098 2.1E-06   38.3   4.9   30    1-33      1-30  (111)
 39 PF14354 Lar_restr_allev:  Rest  94.4   0.041 8.9E-07   35.6   2.7   27    4-31      4-37  (61)
 40 PF09538 FYDLN_acid:  Protein o  94.4   0.025 5.5E-07   41.4   1.9   31    3-36      9-39  (108)
 41 KOG0794 CDK8 kinase-activating  94.3   0.096 2.1E-06   43.4   5.3   53  107-159    43-102 (264)
 42 PF06677 Auto_anti-p27:  Sjogre  94.3   0.044 9.5E-07   33.2   2.4   26    2-30     16-41  (41)
 43 smart00661 RPOL9 RNA polymeras  94.2   0.037 7.9E-07   34.6   2.1   28    5-34      2-31  (52)
 44 TIGR02098 MJ0042_CXXC MJ0042 f  94.2   0.021 4.5E-07   33.6   0.9   29    4-34      3-36  (38)
 45 PF03966 Trm112p:  Trm112p-like  94.1   0.053 1.1E-06   36.2   2.9   17   17-33     47-63  (68)
 46 PRK00464 nrdR transcriptional   94.1   0.043 9.3E-07   42.7   2.8   30    4-33      1-38  (154)
 47 PF09297 zf-NADH-PPase:  NADH p  94.0   0.065 1.4E-06   30.4   2.7   28    3-32      3-30  (32)
 48 TIGR01206 lysW lysine biosynth  93.7   0.033 7.2E-07   35.8   1.2   30    4-34      3-33  (54)
 49 COG1998 RPS31 Ribosomal protei  93.6   0.043 9.3E-07   34.5   1.6   27    4-32     20-46  (51)
 50 COG2835 Uncharacterized conser  93.6   0.055 1.2E-06   35.5   2.0   30    2-33      7-36  (60)
 51 TIGR00244 transcriptional regu  93.5   0.081 1.8E-06   40.8   3.1   30    4-33      1-38  (147)
 52 KOG1598 Transcription initiati  92.8   0.099 2.1E-06   47.8   3.2   22  139-160   207-228 (521)
 53 TIGR02300 FYDLN_acid conserved  92.8   0.071 1.5E-06   40.1   1.9   31    3-36      9-39  (129)
 54 PF08273 Prim_Zn_Ribbon:  Zinc-  92.6    0.11 2.5E-06   31.3   2.3   29    4-32      4-35  (40)
 55 KOG0835 Cyclin L [General func  92.5    0.35 7.5E-06   42.0   5.9   53  108-160   141-202 (367)
 56 COG2824 PhnA Uncharacterized Z  92.3    0.31 6.6E-06   35.6   4.6   33    1-36      1-33  (112)
 57 TIGR00686 phnA alkylphosphonat  92.3    0.29 6.4E-06   35.7   4.5   28    4-34      3-30  (109)
 58 TIGR01384 TFS_arch transcripti  91.9    0.11 2.5E-06   37.2   2.0   28    4-35      1-28  (104)
 59 TIGR03655 anti_R_Lar restricti  91.9    0.13 2.8E-06   32.6   2.0   31    4-34      2-37  (53)
 60 KOG1779 40s ribosomal protein   91.7   0.089 1.9E-06   36.2   1.2   29    4-33     35-63  (84)
 61 PF05191 ADK_lid:  Adenylate ki  91.1   0.031 6.7E-07   32.9  -1.4   30    4-33      2-31  (36)
 62 smart00834 CxxC_CXXC_SSSS Puta  90.7    0.16 3.5E-06   29.9   1.5   30    4-33      6-36  (41)
 63 PF13719 zinc_ribbon_5:  zinc-r  90.7   0.099 2.1E-06   30.8   0.6   30    4-33      3-35  (37)
 64 KOG2496 Cdk activating kinase   90.6    0.63 1.4E-05   40.0   5.5   41  120-160    73-120 (325)
 65 PF12760 Zn_Tnp_IS1595:  Transp  90.5    0.35 7.7E-06   29.6   3.0   28    3-31     18-45  (46)
 66 PF07282 OrfB_Zn_ribbon:  Putat  90.3     0.2 4.3E-06   33.1   1.8   29    4-34     29-57  (69)
 67 PF01780 Ribosomal_L37ae:  Ribo  90.2    0.18 3.9E-06   35.8   1.6   29    4-34     36-64  (90)
 68 COG1594 RPB9 DNA-directed RNA   90.1    0.23 4.9E-06   36.6   2.2   34    3-36      2-35  (113)
 69 COG2888 Predicted Zn-ribbon RN  90.0     0.2 4.4E-06   32.7   1.6   26    5-32     11-36  (61)
 70 PRK05654 acetyl-CoA carboxylas  89.8    0.38 8.3E-06   41.1   3.6   43    4-48     28-77  (292)
 71 smart00659 RPOLCX RNA polymera  89.6    0.27 5.9E-06   30.2   1.9   27    4-33      3-29  (44)
 72 smart00440 ZnF_C2C2 C2C2 Zinc   89.5    0.32   7E-06   29.1   2.1   27    5-32      2-37  (40)
 73 PF09862 DUF2089:  Protein of u  89.4    0.31 6.7E-06   36.0   2.4   26    6-37      1-26  (113)
 74 KOG0835 Cyclin L [General func  89.2     1.5 3.2E-05   38.2   6.7   59  102-160    20-85  (367)
 75 PRK05978 hypothetical protein;  89.2    0.32 6.9E-06   37.6   2.4   35    4-39     34-68  (148)
 76 COG1327 Predicted transcriptio  89.2    0.27 5.9E-06   38.0   2.1   30    4-33      1-38  (156)
 77 PRK12495 hypothetical protein;  89.1    0.26 5.7E-06   40.4   2.0   32    1-36     40-71  (226)
 78 PTZ00255 60S ribosomal protein  89.1     0.3 6.4E-06   34.7   2.0   30    3-34     36-65  (90)
 79 COG4888 Uncharacterized Zn rib  89.0    0.26 5.6E-06   35.6   1.7   29    5-34     24-57  (104)
 80 PF03604 DNA_RNApol_7kD:  DNA d  88.1    0.29 6.4E-06   28.0   1.3   25    5-32      2-26  (32)
 81 PRK14892 putative transcriptio  88.1    0.28 6.1E-06   35.4   1.5   42    4-46     22-71  (99)
 82 PF03119 DNA_ligase_ZBD:  NAD-d  88.0    0.54 1.2E-05   26.0   2.2   22    5-28      1-22  (28)
 83 TIGR00280 L37a ribosomal prote  87.6    0.38 8.3E-06   34.2   1.8   30    3-34     35-64  (91)
 84 PF12773 DZR:  Double zinc ribb  87.0    0.39 8.4E-06   29.6   1.5   12   23-34     12-23  (50)
 85 COG5349 Uncharacterized protei  86.9    0.31 6.7E-06   36.4   1.1   39    4-43     22-60  (126)
 86 PF05129 Elf1:  Transcription e  86.8    0.24 5.2E-06   34.4   0.4   32    5-36     24-59  (81)
 87 PRK03976 rpl37ae 50S ribosomal  86.5    0.46   1E-05   33.7   1.8   30    3-34     36-65  (90)
 88 PRK09710 lar restriction allev  86.4    0.73 1.6E-05   30.6   2.5   28    4-32      7-36  (64)
 89 COG3478 Predicted nucleic-acid  86.3    0.52 1.1E-05   31.3   1.8   14    5-19      6-19  (68)
 90 PRK14890 putative Zn-ribbon RN  85.6    0.71 1.5E-05   30.1   2.1   29    2-32      6-34  (59)
 91 PF01096 TFIIS_C:  Transcriptio  85.3    0.61 1.3E-05   27.7   1.6   27    5-32      2-37  (39)
 92 PF09855 DUF2082:  Nucleic-acid  85.1    0.83 1.8E-05   30.3   2.3   27    5-32      2-45  (64)
 93 PRK09678 DNA-binding transcrip  84.6       1 2.2E-05   30.6   2.6   31    3-34      1-40  (72)
 94 PRK06266 transcription initiat  84.0    0.27 5.8E-06   39.1  -0.5   31    4-35    118-148 (178)
 95 PF14255 Cys_rich_CPXG:  Cystei  84.0    0.76 1.7E-05   29.3   1.7   28    5-32      2-33  (52)
 96 PRK02935 hypothetical protein;  83.6    0.85 1.8E-05   33.2   2.0   38    4-48     71-108 (110)
 97 COG4640 Predicted membrane pro  83.3    0.66 1.4E-05   41.2   1.6   28    3-36      1-28  (465)
 98 PF13717 zinc_ribbon_4:  zinc-r  82.1    0.54 1.2E-05   27.5   0.4   29    4-33      3-35  (36)
 99 COG1996 RPC10 DNA-directed RNA  82.0    0.51 1.1E-05   29.7   0.3   28    4-33      7-34  (49)
100 TIGR02443 conserved hypothetic  82.0     1.5 3.3E-05   28.6   2.5   30    3-32      9-40  (59)
101 PRK12286 rpmF 50S ribosomal pr  82.0    0.85 1.8E-05   29.6   1.4   27    4-37     28-54  (57)
102 TIGR02605 CxxC_CxxC_SSSS putat  81.8     0.9 1.9E-05   28.3   1.4   28    4-31      6-34  (52)
103 KOG4164 Cyclin ik3-1/CABLES [C  81.4     2.7 5.9E-05   37.5   4.7   49  110-158   387-442 (497)
104 cd00350 rubredoxin_like Rubred  81.3     1.3 2.7E-05   25.3   1.8   23    5-31      3-25  (33)
105 PF15616 TerY-C:  TerY-C metal   81.3     0.9 1.9E-05   34.4   1.5    7    5-11     79-85  (131)
106 PF14446 Prok-RING_1:  Prokaryo  81.0     1.3 2.8E-05   28.5   1.9   27    3-33      5-31  (54)
107 PRK13130 H/ACA RNA-protein com  80.9    0.77 1.7E-05   29.7   0.9   24    2-33      4-27  (56)
108 PF06827 zf-FPG_IleRS:  Zinc fi  80.9    0.99 2.1E-05   25.0   1.2   28    4-31      2-29  (30)
109 PF11672 DUF3268:  Protein of u  80.8     1.4 3.1E-05   31.9   2.3   31    3-34      2-42  (102)
110 PF11023 DUF2614:  Protein of u  80.6    0.51 1.1E-05   34.7  -0.0   39    4-49     70-108 (114)
111 PF05876 Terminase_GpA:  Phage   80.3    0.94   2E-05   42.1   1.6   43    4-46    201-255 (557)
112 PRK08402 replication factor A;  80.2     1.4   3E-05   38.8   2.5   27    4-32    213-239 (355)
113 KOG1088 Uncharacterized conser  79.9    0.71 1.5E-05   34.3   0.5   17   17-33     92-108 (124)
114 PF14122 YokU:  YokU-like prote  79.8     1.2 2.5E-05   31.3   1.5   23   21-43     33-55  (87)
115 PRK12336 translation initiatio  79.4     1.2 2.7E-05   35.9   1.8   29    4-32     99-128 (201)
116 PRK08351 DNA-directed RNA poly  79.2     1.1 2.3E-05   29.6   1.1   32    1-46      1-32  (61)
117 PF10058 DUF2296:  Predicted in  78.4     1.1 2.3E-05   28.7   0.9   29    4-32     23-53  (54)
118 PHA02942 putative transposase;  77.9     1.5 3.2E-05   38.9   2.0   28    4-34    326-353 (383)
119 CHL00174 accD acetyl-CoA carbo  77.6    0.45 9.7E-06   40.8  -1.3   30    4-34     39-68  (296)
120 PF09723 Zn-ribbon_8:  Zinc rib  77.5     1.4 3.1E-05   26.5   1.3   28    4-31      6-34  (42)
121 TIGR00515 accD acetyl-CoA carb  77.4    0.47   1E-05   40.5  -1.2   30    4-34     27-56  (285)
122 PF01783 Ribosomal_L32p:  Ribos  77.3     1.6 3.5E-05   28.0   1.6   28    4-38     27-54  (56)
123 TIGR03826 YvyF flagellar opero  76.8    0.61 1.3E-05   35.6  -0.6   30    1-35      1-30  (137)
124 PRK00241 nudC NADH pyrophospha  76.1       2 4.3E-05   36.0   2.2   29    3-33     99-127 (256)
125 COG1773 Rubredoxin [Energy pro  76.1     2.1 4.5E-05   27.6   1.8   26    1-30      1-26  (55)
126 PF14952 zf-tcix:  Putative tre  76.0     1.7 3.6E-05   26.7   1.3   25    4-34     12-38  (44)
127 COG4068 Uncharacterized protei  75.8    0.53 1.2E-05   30.7  -1.0   26    3-34      8-34  (64)
128 KOG4557 Origin recognition com  75.5     3.9 8.4E-05   33.7   3.6   49  111-159    95-154 (262)
129 PF04161 Arv1:  Arv1-like famil  75.5     1.5 3.1E-05   35.6   1.2   34    4-37      1-38  (208)
130 PF08646 Rep_fac-A_C:  Replicat  75.3     2.6 5.6E-05   31.8   2.5   27    5-34     20-48  (146)
131 COG3877 Uncharacterized protei  75.2     2.8 6.1E-05   30.7   2.5   28    4-37      7-34  (122)
132 TIGR01031 rpmF_bact ribosomal   75.1     1.9 4.1E-05   27.7   1.4   26    4-36     27-52  (55)
133 smart00401 ZnF_GATA zinc finge  74.7     3.1 6.6E-05   26.3   2.3   32    3-34      3-36  (52)
134 PRK12366 replication factor A;  74.5     2.1 4.5E-05   40.5   2.1   25    4-32    533-557 (637)
135 PF09526 DUF2387:  Probable met  74.2     3.6 7.8E-05   27.8   2.7   31    3-33      8-40  (71)
136 PF06397 Desulfoferrod_N:  Desu  74.1       2 4.3E-05   25.3   1.2   22    4-26      7-28  (36)
137 PF00301 Rubredoxin:  Rubredoxi  73.7     1.8 3.9E-05   26.9   1.0   16   24-39      2-17  (47)
138 COG1656 Uncharacterized conser  73.3     1.5 3.3E-05   34.5   0.8   29    3-33     97-140 (165)
139 cd00730 rubredoxin Rubredoxin;  73.2     2.8   6E-05   26.4   1.8   13   24-36      2-14  (50)
140 KOG2906 RNA polymerase III sub  73.0     2.8 6.1E-05   30.2   2.0   30    4-34      2-32  (105)
141 cd04476 RPA1_DBD_C RPA1_DBD_C:  72.6       3 6.5E-05   32.1   2.3   27    4-33     35-61  (166)
142 COG1326 Uncharacterized archae  72.5     1.5 3.3E-05   35.3   0.6   31    4-35      7-42  (201)
143 PRK12380 hydrogenase nickel in  72.5     2.3   5E-05   31.2   1.6    6   25-30     88-93  (113)
144 COG2093 DNA-directed RNA polym  72.3     2.2 4.8E-05   28.2   1.2   34    2-47      3-36  (64)
145 KOG1010 Rb (Retinoblastoma tum  71.1     9.4  0.0002   37.2   5.6   51  109-159    35-91  (920)
146 TIGR00100 hypA hydrogenase nic  70.5     2.8 6.1E-05   30.8   1.6   18   14-31     61-78  (115)
147 PRK14559 putative protein seri  70.4     2.7 5.8E-05   39.8   1.9    7    5-11      3-9   (645)
148 PF13453 zf-TFIIB:  Transcripti  70.0     3.8 8.2E-05   24.3   1.8   28    5-33      1-29  (41)
149 PF10122 Mu-like_Com:  Mu-like   70.0     1.2 2.6E-05   28.2  -0.3   31    2-33      3-34  (51)
150 TIGR03830 CxxCG_CxxCG_HTH puta  70.0     3.6 7.7E-05   29.9   2.1   11   23-33     31-41  (127)
151 PF12172 DUF35_N:  Rubredoxin-l  69.6     2.6 5.6E-05   24.4   1.0   21    4-30     12-32  (37)
152 TIGR01384 TFS_arch transcripti  68.5     4.8  0.0001   28.6   2.5   28    4-32     63-99  (104)
153 PF07754 DUF1610:  Domain of un  68.0     4.2 9.1E-05   21.7   1.5   23    6-31      1-24  (24)
154 COG0777 AccD Acetyl-CoA carbox  67.2     1.5 3.2E-05   37.3  -0.5   30    4-34     29-58  (294)
155 PF04606 Ogr_Delta:  Ogr/Delta-  67.0     4.2 9.1E-05   25.0   1.7   28    5-33      1-37  (47)
156 KOG0402 60S ribosomal protein   67.0     1.8 3.8E-05   30.3  -0.1   30    3-34     36-65  (92)
157 PRK03824 hypA hydrogenase nick  66.5     3.8 8.2E-05   31.0   1.6   21   14-34     61-81  (135)
158 COG4530 Uncharacterized protei  65.6     3.4 7.4E-05   30.5   1.2   33    3-38      9-41  (129)
159 TIGR00155 pqiA_fam integral me  65.2     4.9 0.00011   35.9   2.4   30    5-34     15-44  (403)
160 TIGR00569 ccl1 cyclin ccl1. Un  64.8      27 0.00058   30.1   6.7   23  139-161   204-226 (305)
161 KOG3134 Predicted membrane pro  64.8     1.9 4.1E-05   35.4  -0.3   34    4-37      1-38  (225)
162 PF06044 DRP:  Dam-replacing fa  64.5     4.1 8.8E-05   34.1   1.6   30    4-34     32-64  (254)
163 PRK05508 methionine sulfoxide   64.2     6.3 0.00014   29.4   2.4   33   18-50     28-62  (119)
164 PF01155 HypA:  Hydrogenase exp  64.1     1.8   4E-05   31.6  -0.5   24    5-32     72-95  (113)
165 KOG2593 Transcription initiati  64.0     3.5 7.6E-05   37.0   1.2   32    3-34    128-164 (436)
166 TIGR00319 desulf_FeS4 desulfof  63.5     5.7 0.00012   22.5   1.7   23    4-27      8-30  (34)
167 PF08063 PADR1:  PADR1 (NUC008)  63.5     4.4 9.6E-05   25.9   1.3   21    4-27     15-35  (55)
168 cd00729 rubredoxin_SM Rubredox  63.5     6.5 0.00014   22.6   1.9    8   24-31     19-26  (34)
169 TIGR00595 priA primosomal prot  63.5     6.1 0.00013   36.2   2.7   29    4-34    223-251 (505)
170 cd00974 DSRD Desulforedoxin (D  63.4     5.7 0.00012   22.6   1.6   24    4-28      5-28  (34)
171 PF01599 Ribosomal_S27:  Riboso  63.4     9.1  0.0002   23.8   2.6   26    4-31     19-46  (47)
172 PF14768 RPA_interact_C:  Repli  62.9     5.9 0.00013   27.3   2.0   26    5-34      1-26  (82)
173 PRK03564 formate dehydrogenase  62.9     6.9 0.00015   33.8   2.8   10   24-33    253-262 (309)
174 PRK14559 putative protein seri  62.8     4.3 9.2E-05   38.5   1.6   24    5-34     29-52  (645)
175 PRK05580 primosome assembly pr  62.5     6.5 0.00014   37.4   2.8   29    4-34    391-419 (679)
176 KOG1010 Rb (Retinoblastoma tum  62.1      15 0.00033   35.8   5.1   54  107-160   679-741 (920)
177 PRK03681 hypA hydrogenase nick  60.9     5.3 0.00012   29.3   1.5   16   15-30     62-77  (114)
178 PF14206 Cys_rich_CPCC:  Cystei  60.9     8.8 0.00019   26.4   2.5   26    4-32      2-29  (78)
179 TIGR01562 FdhE formate dehydro  60.8     7.6 0.00016   33.5   2.6   32    3-34    224-263 (305)
180 PRK06393 rpoE DNA-directed RNA  60.8     3.6 7.8E-05   27.3   0.5   20    4-31      6-25  (64)
181 PF14353 CpXC:  CpXC protein     60.4       8 0.00017   28.5   2.4   12   23-34     38-49  (128)
182 KOG2907 RNA polymerase I trans  60.2     3.6 7.9E-05   30.3   0.5   32    3-36      7-38  (116)
183 cd00202 ZnF_GATA Zinc finger D  60.1     3.3 7.2E-05   26.4   0.3   29    6-34      2-32  (54)
184 PRK15103 paraquat-inducible me  59.8     6.1 0.00013   35.5   2.0   32    4-36     11-43  (419)
185 PRK14873 primosome assembly pr  59.4     7.2 0.00016   37.1   2.5   27    4-32    393-419 (665)
186 PRK07218 replication factor A;  59.2     4.2   9E-05   36.6   0.8   21    4-32    298-318 (423)
187 PF04502 DUF572:  Family of unk  59.1     4.7  0.0001   34.9   1.1   25    4-28     78-102 (324)
188 PRK04023 DNA polymerase II lar  59.0     7.1 0.00015   38.8   2.4   11   24-34    664-674 (1121)
189 PF04810 zf-Sec23_Sec24:  Sec23  58.9      12 0.00026   22.1   2.6   30    3-32      2-33  (40)
190 PF13824 zf-Mss51:  Zinc-finger  58.7     7.3 0.00016   25.1   1.7   24    5-33      1-24  (55)
191 PF10080 DUF2318:  Predicted me  58.1     9.2  0.0002   27.7   2.3   30    4-36     36-65  (102)
192 PF14471 DUF4428:  Domain of un  57.6     3.3 7.1E-05   26.1  -0.1   28    5-33      1-30  (51)
193 COG0333 RpmF Ribosomal protein  57.1     6.7 0.00014   25.4   1.3   25    4-35     28-52  (57)
194 PF02984 Cyclin_C:  Cyclin, C-t  57.1      26 0.00057   24.4   4.6   19  139-157    41-59  (118)
195 TIGR03829 YokU_near_AblA uncha  56.6     8.8 0.00019   27.1   1.9   34    5-38      1-50  (89)
196 PF01485 IBR:  IBR domain;  Int  56.3     6.5 0.00014   24.7   1.2   28    4-33     19-50  (64)
197 PF13790 DUF4182:  Domain of un  56.2     5.8 0.00013   23.6   0.8   13   22-34      2-14  (38)
198 KOG3507 DNA-directed RNA polym  55.9     6.4 0.00014   25.7   1.0   25    5-33     22-47  (62)
199 PF03833 PolC_DP2:  DNA polymer  55.6     3.8 8.3E-05   39.8   0.0   11   24-34    681-691 (900)
200 PRK00222 methionine sulfoxide   54.7      11 0.00024   28.9   2.4   34   17-50     37-72  (142)
201 PF08772 NOB1_Zn_bind:  Nin one  54.7     6.4 0.00014   26.8   1.0   11    1-11     22-32  (73)
202 PF01807 zf-CHC2:  CHC2 zinc fi  54.6      12 0.00025   26.5   2.4   27    5-31     35-62  (97)
203 PRK00564 hypA hydrogenase nick  54.5     5.5 0.00012   29.3   0.7   19   14-32     62-80  (117)
204 PRK14714 DNA polymerase II lar  54.5     7.7 0.00017   39.4   1.8    6    5-10    669-674 (1337)
205 smart00290 ZnF_UBP Ubiquitin C  54.5      11 0.00024   22.8   2.0   23    5-35      1-23  (50)
206 COG1198 PriA Primosomal protei  54.2      11 0.00023   36.4   2.7   27    4-32    445-471 (730)
207 PRK06260 threonine synthase; V  54.1     5.6 0.00012   35.2   0.8   30    1-34      1-30  (397)
208 PF01412 ArfGap:  Putative GTPa  54.0       5 0.00011   29.3   0.4   30    4-33     14-43  (116)
209 PRK00085 recO DNA repair prote  53.4     9.3  0.0002   31.1   1.9   27    4-30    150-177 (247)
210 cd07973 Spt4 Transcription elo  53.2       9 0.00019   27.5   1.6   27    4-33      4-30  (98)
211 smart00647 IBR In Between Ring  53.1      12 0.00027   23.5   2.1   28    4-33     19-50  (64)
212 PF09889 DUF2116:  Uncharacteri  52.7     2.8 6.1E-05   27.4  -1.0   27    3-35      3-30  (59)
213 PF07191 zinc-ribbons_6:  zinc-  52.4     9.5 0.00021   25.8   1.5   26    4-33      2-27  (70)
214 KOG0656 G1/S-specific cyclin D  52.4      58  0.0013   28.5   6.7   55  106-160    79-145 (335)
215 PRK06386 replication factor A;  52.1     6.9 0.00015   34.5   1.0   21    4-32    237-257 (358)
216 PRK14526 adenylate kinase; Pro  52.1      10 0.00022   30.6   2.0   33    4-36    123-155 (211)
217 PF00320 GATA:  GATA zinc finge  51.8     5.4 0.00012   23.1   0.2   27    6-32      1-29  (36)
218 TIGR00613 reco DNA repair prot  51.7      11 0.00023   30.6   2.0   28    4-31    148-176 (241)
219 PF13878 zf-C2H2_3:  zinc-finge  51.6     6.1 0.00013   23.7   0.4   16   22-37     12-27  (41)
220 PRK00750 lysK lysyl-tRNA synth  51.3      12 0.00025   34.5   2.4   33    5-38    177-214 (510)
221 TIGR00310 ZPR1_znf ZPR1 zinc f  51.3      11 0.00024   30.3   1.9   30    5-34      2-41  (192)
222 PF09082 DUF1922:  Domain of un  50.3      11 0.00024   25.3   1.6   26    5-34      5-30  (68)
223 PF04216 FdhE:  Protein involve  50.2     9.6 0.00021   32.2   1.6   29    4-32    173-206 (290)
224 smart00105 ArfGap Putative GTP  49.4     8.6 0.00019   27.9   1.0   31    4-34      4-34  (112)
225 COG2816 NPY1 NTP pyrophosphohy  49.3      11 0.00024   32.1   1.8   30    3-34    111-140 (279)
226 COG5333 CCL1 Cdk activating ki  49.2      46   0.001   28.6   5.5   62   99-160   125-211 (297)
227 PRK08197 threonine synthase; V  47.6     8.2 0.00018   34.1   0.8   27    3-34      7-33  (394)
228 TIGR00357 methionine-R-sulfoxi  47.1      14 0.00031   28.0   1.9   33   18-50     35-69  (134)
229 COG4391 Uncharacterized protei  45.8      12 0.00026   24.7   1.1   20   15-34     39-59  (62)
230 COG4643 Uncharacterized protei  45.2      13 0.00028   32.6   1.6   26    5-30     34-61  (366)
231 PF10005 DUF2248:  Uncharacteri  45.1      13 0.00028   32.6   1.6   25    5-35      1-25  (343)
232 TIGR00340 zpr1_rel ZPR1-relate  45.0      18  0.0004   28.3   2.3   29    6-34      1-39  (163)
233 PRK01110 rpmF 50S ribosomal pr  44.3      12 0.00026   24.4   1.0   28    4-39     28-55  (60)
234 cd00674 LysRS_core_class_I cat  44.3      18 0.00038   31.9   2.3   33    4-37    170-206 (353)
235 PHA03074 late transcription fa  43.9      15 0.00032   30.0   1.6   30    2-34      3-32  (225)
236 PF09334 tRNA-synt_1g:  tRNA sy  43.8      11 0.00025   33.3   1.1   24    4-34    137-160 (391)
237 COG1571 Predicted DNA-binding   43.6      14 0.00031   33.2   1.7   32    5-39    352-383 (421)
238 PF14369 zf-RING_3:  zinc-finge  42.1      17 0.00036   21.0   1.3   26    4-31      3-29  (35)
239 PRK06450 threonine synthase; V  41.2      12 0.00027   32.4   0.9   29    1-34      1-29  (338)
240 COG2260 Predicted Zn-ribbon RN  41.0      15 0.00032   24.0   1.0   22    4-33      6-27  (59)
241 PF01363 FYVE:  FYVE zinc finge  40.8      19 0.00041   23.4   1.5   30    4-37     10-39  (69)
242 PRK14714 DNA polymerase II lar  40.6      13 0.00029   37.8   1.1    8    5-12    681-688 (1337)
243 PF14319 Zn_Tnp_IS91:  Transpos  40.6     8.9 0.00019   28.0  -0.1   34    4-39     43-76  (111)
244 PF13408 Zn_ribbon_recom:  Reco  40.3      15 0.00031   22.7   0.9   14   21-34      3-16  (58)
245 TIGR02642 phage_xxxx uncharact  40.0      18 0.00038   29.1   1.5   23    4-30    100-122 (186)
246 PF14149 YhfH:  YhfH-like prote  39.7     5.3 0.00012   23.6  -1.1   16   21-36     11-26  (37)
247 PF12677 DUF3797:  Domain of un  39.7      23 0.00049   22.2   1.6    8    4-11     14-21  (49)
248 PRK08329 threonine synthase; V  39.5      19 0.00042   31.2   1.8   25    4-34      2-26  (347)
249 PF14690 zf-ISL3:  zinc-finger   39.3      20 0.00044   21.3   1.4    8    4-11      3-10  (47)
250 PF06689 zf-C4_ClpX:  ClpX C4-t  39.1      12 0.00027   22.3   0.4   26    4-29      2-30  (41)
251 PF14951 DUF4503:  Domain of un  39.0      21 0.00045   31.6   1.9   38    5-43    276-314 (389)
252 KOG0794 CDK8 kinase-activating  38.5      41 0.00089   28.1   3.5   22  139-160   192-213 (264)
253 PRK00133 metG methionyl-tRNA s  38.4      16 0.00034   34.7   1.2   22    5-33    141-162 (673)
254 PF07295 DUF1451:  Protein of u  38.4      15 0.00031   28.3   0.8   15   20-34    109-123 (146)
255 COG1779 C4-type Zn-finger prot  38.2      20 0.00044   29.1   1.6   36    4-40     15-60  (201)
256 COG0143 MetG Methionyl-tRNA sy  37.9      18  0.0004   33.7   1.5   25    5-36    144-168 (558)
257 COG2126 RPL37A Ribosomal prote  37.7      18 0.00039   23.6   1.0   25    4-33     17-41  (61)
258 smart00709 Zpr1 Duplicated dom  37.5      28 0.00061   27.1   2.3   29    5-33      2-39  (160)
259 PF01907 Ribosomal_L37e:  Ribos  37.5      23  0.0005   22.8   1.5   24    4-32     16-39  (55)
260 COG3677 Transposase and inacti  37.4      24 0.00052   26.5   1.8   30    3-33     30-63  (129)
261 PLN02569 threonine synthase     37.2      19  0.0004   33.0   1.4   27    3-34     49-75  (484)
262 PF01396 zf-C4_Topoisom:  Topoi  37.2      33 0.00071   20.2   2.0   29    4-33      2-34  (39)
263 PF14205 Cys_rich_KTR:  Cystein  37.1      29 0.00062   22.3   1.8   27    5-31      6-36  (55)
264 smart00064 FYVE Protein presen  37.0      26 0.00056   22.6   1.7   30    4-37     11-40  (68)
265 PF01641 SelR:  SelR domain;  I  36.9      19 0.00042   27.0   1.2   33   18-50     32-66  (124)
266 PF03367 zf-ZPR1:  ZPR1 zinc-fi  36.7      15 0.00033   28.5   0.7   30    4-33      2-40  (161)
267 COG0229 Conserved domain frequ  36.4      27 0.00059   26.7   2.0   33   18-50     37-71  (140)
268 PF08421 Methyltransf_13:  Puta  36.3      20 0.00044   23.2   1.1   17   23-39     40-56  (62)
269 PF02236 Viral_DNA_bi:  Viral D  36.1      49  0.0011   23.2   3.1   59  105-174     6-70  (86)
270 PRK04179 rpl37e 50S ribosomal   35.8      19  0.0004   23.8   0.9   24    3-31     17-40  (62)
271 PRK00118 putative DNA-binding   35.7 1.2E+02  0.0026   21.9   5.2   40  111-150    35-87  (104)
272 COG5134 Uncharacterized conser  35.3      32  0.0007   28.4   2.3   25    4-28     80-104 (272)
273 PRK07591 threonine synthase; V  35.1      16 0.00034   32.7   0.6   26    4-34     19-44  (421)
274 PRK03564 formate dehydrogenase  34.6      24 0.00053   30.5   1.7   29    3-31    187-220 (309)
275 PHA00689 hypothetical protein   34.2      28 0.00061   22.0   1.5   27   20-47     14-40  (62)
276 PRK00448 polC DNA polymerase I  34.0      22 0.00048   36.9   1.5   31    3-34    908-944 (1437)
277 PRK05638 threonine synthase; V  33.9      22 0.00048   31.9   1.3   25    4-34      2-26  (442)
278 PRK04023 DNA polymerase II lar  33.7      26 0.00056   35.1   1.8    8    4-11    627-634 (1121)
279 PF05460 ORC6:  Origin recognit  33.7      14  0.0003   32.5   0.0   46  114-159     3-58  (353)
280 cd00065 FYVE FYVE domain; Zinc  33.6      33 0.00071   21.2   1.8   30    4-37      3-32  (57)
281 PF00130 C1_1:  Phorbol esters/  33.5      36 0.00079   20.7   1.9   35    3-40     11-45  (53)
282 PF02591 DUF164:  Putative zinc  33.3      24 0.00052   22.2   1.1   31    3-33     22-56  (56)
283 TIGR03060 PS_II_psb29 photosys  33.2      62  0.0013   26.6   3.7   29  109-137   165-195 (214)
284 PRK11475 DNA-binding transcrip  33.0      86  0.0019   25.1   4.6   56   99-155   136-197 (207)
285 PRK00279 adk adenylate kinase;  32.6      36 0.00077   27.0   2.2   33    4-36    128-160 (215)
286 COG5525 Bacteriophage tail ass  32.6      23  0.0005   33.3   1.2   33    4-36    228-272 (611)
287 TIGR00354 polC DNA polymerase,  32.5      16 0.00034   36.3   0.2   23    3-33    625-647 (1095)
288 smart00400 ZnF_CHCC zinc finge  32.5      60  0.0013   20.1   2.9   26    5-30      4-30  (55)
289 PRK09462 fur ferric uptake reg  32.0      23 0.00049   26.7   1.0   12   23-34     90-101 (148)
290 PRK13266 Thf1-like protein; Re  31.9      66  0.0014   26.6   3.7   29  109-137   167-197 (225)
291 PRK04016 DNA-directed RNA poly  31.7      22 0.00047   23.5   0.7   13   24-36      5-17  (62)
292 PF13913 zf-C2HC_2:  zinc-finge  31.5      30 0.00065   18.2   1.1    9    3-11      2-10  (25)
293 TIGR00467 lysS_arch lysyl-tRNA  31.4      29 0.00063   32.1   1.7   33    4-37    169-204 (515)
294 COG3809 Uncharacterized protei  31.4      40 0.00086   23.4   1.9   28    4-33      2-31  (88)
295 COG4311 SoxD Sarcosine oxidase  31.3      26 0.00056   25.1   1.1   12    1-12      1-12  (97)
296 PRK08173 DNA topoisomerase III  31.2      31 0.00066   34.0   1.9   27    4-34    625-651 (862)
297 COG1499 NMD3 NMD protein affec  31.0      18 0.00039   31.9   0.3   12    1-12      4-15  (355)
298 PRK07956 ligA NAD-dependent DN  30.8      37 0.00079   32.5   2.3   34    3-38    404-440 (665)
299 COG0375 HybF Zn finger protein  30.7      27 0.00057   25.9   1.1   19   15-33     62-80  (115)
300 PHA02540 61 DNA primase; Provi  30.7      48   0.001   29.0   2.8   28    5-32     29-64  (337)
301 PRK00762 hypA hydrogenase nick  30.6      22 0.00049   26.3   0.7   18   14-32     61-78  (124)
302 PF03811 Zn_Tnp_IS1:  InsA N-te  30.6      27 0.00059   20.3   0.9   10    4-14      6-15  (36)
303 cd07153 Fur_like Ferric uptake  30.6      25 0.00054   24.9   0.9   13   22-34     72-84  (116)
304 PF11264 ThylakoidFormat:  Thyl  30.5      78  0.0017   26.0   3.9   30  108-137   161-192 (216)
305 COG0735 Fur Fe2+/Zn2+ uptake r  30.3      25 0.00054   26.7   0.9   13   22-34     92-104 (145)
306 TIGR01391 dnaG DNA primase, ca  30.2      51  0.0011   29.4   3.0   34    5-40     36-70  (415)
307 smart00504 Ubox Modified RING   29.9      17 0.00038   22.8  -0.0   29    4-40      2-30  (63)
308 PF10886 DUF2685:  Protein of u  29.7      29 0.00062   22.3   1.0   36    4-40      2-40  (54)
309 TIGR01405 polC_Gram_pos DNA po  29.5      30 0.00064   35.4   1.5   31    3-34    683-719 (1213)
310 cd01410 SIRT7 SIRT7: Eukaryoti  29.4      35 0.00076   27.4   1.7   38    3-41     95-138 (206)
311 PF00488 MutS_V:  MutS domain V  29.3      62  0.0013   26.5   3.2   23  114-136   210-234 (235)
312 PF01475 FUR:  Ferric uptake re  29.2      27 0.00059   25.1   0.9   13   22-34     79-91  (120)
313 PF01921 tRNA-synt_1f:  tRNA sy  29.1      13 0.00028   32.8  -0.9   34    5-38    176-214 (360)
314 cd00021 BBOX B-Box-type zinc f  29.1      47   0.001   18.5   1.8   26    5-30      2-27  (39)
315 COG1885 Uncharacterized protei  29.0      42  0.0009   24.5   1.8    8    4-11     50-57  (115)
316 COG1107 Archaea-specific RecJ-  28.8      40 0.00086   32.0   2.1   28    4-32      3-30  (715)
317 COG2023 RPR2 RNase P subunit R  28.7      46 0.00099   24.3   2.0   31    4-34     57-93  (105)
318 COG4307 Uncharacterized protei  28.7      24 0.00051   30.2   0.6   28    1-34      1-28  (349)
319 COG2979 Uncharacterized protei  28.6      66  0.0014   26.5   3.1   20  109-128   194-213 (225)
320 PF03685 UPF0147:  Uncharacteri  28.6 1.9E+02  0.0042   20.2   5.0   50  101-150     4-56  (85)
321 smart00550 Zalpha Z-DNA-bindin  28.3      99  0.0022   20.1   3.5   27  111-137    24-50  (68)
322 PF12651 RHH_3:  Ribbon-helix-h  28.2 1.4E+02   0.003   17.9   4.3   22  107-128    12-34  (44)
323 PRK11032 hypothetical protein;  28.2      27  0.0006   27.3   0.8   14   20-33    121-134 (160)
324 COG0846 SIR2 NAD-dependent pro  28.1      27 0.00058   29.3   0.8   39    3-41    122-165 (250)
325 PF00628 PHD:  PHD-finger;  Int  28.0      38 0.00081   20.4   1.3   26    5-35      1-26  (51)
326 PF09779 Ima1_N:  Ima1 N-termin  28.0      43 0.00093   25.1   1.9   28    5-32      2-29  (131)
327 PF06676 DUF1178:  Protein of u  27.9      35 0.00077   26.3   1.4    8    4-11     33-40  (148)
328 TIGR00575 dnlj DNA ligase, NAD  27.8      44 0.00095   31.8   2.3   34    3-38    392-427 (652)
329 PTZ00408 NAD-dependent deacety  27.4      24 0.00053   29.2   0.5   39    3-41    117-157 (242)
330 PRK00481 NAD-dependent deacety  27.2      39 0.00083   27.7   1.6   38    3-41    122-160 (242)
331 PRK09263 anaerobic ribonucleos  27.2      34 0.00073   33.0   1.4   26    4-31    642-667 (711)
332 TIGR03831 YgiT_finger YgiT-typ  27.2      44 0.00095   19.5   1.5   14   20-33     29-42  (46)
333 TIGR00320 dfx_rbo desulfoferro  27.1      40 0.00086   25.2   1.5   26    4-32      8-33  (125)
334 KOG0856 Predicted pilin-like t  27.0      49  0.0011   25.4   2.0   33   18-50     49-83  (146)
335 cd01411 SIR2H SIR2H: Uncharact  26.8      34 0.00074   27.8   1.2   37    3-41    118-154 (225)
336 PF09845 DUF2072:  Zn-ribbon co  26.7      29 0.00063   26.3   0.7   13   25-37      3-15  (131)
337 PRK11639 zinc uptake transcrip  26.5      31 0.00068   26.8   0.9   12   23-34    100-111 (169)
338 PF10083 DUF2321:  Uncharacteri  26.4      38 0.00083   26.4   1.3   27    5-40     30-56  (158)
339 PRK07217 replication factor A;  26.1      33 0.00072   29.7   1.1   21    4-32    189-211 (311)
340 TIGR01053 LSD1 zinc finger dom  25.9      84  0.0018   17.6   2.4   27    4-32      2-28  (31)
341 KOG3251 Golgi SNAP receptor co  25.7 3.3E+02  0.0071   22.4   6.7   27  102-128   156-182 (213)
342 KOG2272 Focal adhesion protein  25.6      20 0.00044   30.3  -0.3   24   21-44    193-217 (332)
343 PLN03060 inositol phosphatase-  25.5      90  0.0019   25.5   3.4   27  111-137   159-187 (206)
344 KOG0006 E3 ubiquitin-protein l  25.4      39 0.00086   29.6   1.4   32    1-34    313-347 (446)
345 PRK00039 ruvC Holliday junctio  25.1      82  0.0018   24.4   3.0   63  102-165    43-106 (164)
346 COG1644 RPB10 DNA-directed RNA  25.0      25 0.00054   23.2   0.1   13   24-36      5-17  (63)
347 COG4393 Predicted membrane pro  25.0      32  0.0007   30.3   0.8   27    5-34    336-362 (405)
348 smart00109 C1 Protein kinase C  25.0      50  0.0011   19.2   1.5   30    3-36     11-40  (49)
349 PRK04338 N(2),N(2)-dimethylgua  25.0      42 0.00091   29.7   1.5   34    5-45    246-279 (382)
350 PRK15103 paraquat-inducible me  24.6      51  0.0011   29.6   2.0   10   24-33    236-245 (419)
351 PRK05667 dnaG DNA primase; Val  24.6      73  0.0016   29.9   3.1   27    5-31     38-65  (580)
352 PF00643 zf-B_box:  B-box zinc   24.5      52  0.0011   18.9   1.4    9    3-11      3-11  (42)
353 PHA02956 hypothetical protein;  24.4      49  0.0011   25.5   1.6   20   13-32    107-126 (189)
354 COG5347 GTPase-activating prot  24.3      64  0.0014   28.0   2.5   30    4-33     21-50  (319)
355 PRK14067 exodeoxyribonuclease   24.2 1.3E+02  0.0029   20.6   3.6   37  100-136     4-42  (80)
356 COG0272 Lig NAD-dependent DNA   24.2      50  0.0011   31.6   1.9   36    3-40    404-442 (667)
357 PF13005 zf-IS66:  zinc-finger   24.1      45 0.00097   19.9   1.1    8    4-11      3-10  (47)
358 PRK04330 hypothetical protein;  24.0 2.7E+02  0.0057   19.7   5.6   51  100-150     6-59  (88)
359 PRK05550 bifunctional methioni  23.9      56  0.0012   28.0   2.0   33   18-50     31-65  (283)
360 TIGR00617 rpa1 replication fac  23.9      55  0.0012   30.9   2.1   27    4-33    475-503 (608)
361 PF04981 NMD3:  NMD3 family ;    23.9      32  0.0007   28.2   0.5   31    5-35     15-47  (236)
362 PF06906 DUF1272:  Protein of u  23.9      47   0.001   21.5   1.2    7   25-31     43-49  (57)
363 COG1675 TFA1 Transcription ini  23.7      17 0.00037   28.9  -1.0   31    4-36    114-145 (176)
364 PF11020 DUF2610:  Domain of un  23.6   2E+02  0.0044   19.9   4.3   25  120-144    45-72  (82)
365 PRK14715 DNA polymerase II lar  22.9      42 0.00092   34.7   1.2   23    4-34    675-697 (1627)
366 TIGR00155 pqiA_fam integral me  22.8      54  0.0012   29.3   1.8   37   17-63      7-43  (403)
367 COG5319 Uncharacterized protei  22.7      33 0.00072   26.0   0.4   11   22-32     31-41  (142)
368 cd00029 C1 Protein kinase C co  22.4      49  0.0011   19.5   1.0   31    3-36     11-41  (50)
369 TIGR00570 cdk7 CDK-activating   22.4      59  0.0013   28.2   1.9   11    1-11      1-11  (309)
370 PRK14018 trifunctional thiored  22.3      68  0.0015   29.8   2.4   33   18-50    413-447 (521)
371 PLN00047 photosystem II biogen  22.2 1.1E+02  0.0023   26.3   3.4   28  110-137   211-240 (283)
372 COG2176 PolC DNA polymerase II  22.2      52  0.0011   33.8   1.6   31    3-34    914-950 (1444)
373 cd01413 SIR2_Af2 SIR2_Af2: Arc  22.2      51  0.0011   26.7   1.4   38    3-40    113-153 (222)
374 PF08996 zf-DNA_Pol:  DNA Polym  21.8      64  0.0014   25.5   1.9   34    4-39     19-61  (188)
375 COG2331 Uncharacterized protei  21.8      15 0.00033   25.2  -1.4   29    5-33     14-43  (82)
376 PF00196 GerE:  Bacterial regul  21.6 1.4E+02  0.0031   18.3   3.2   24  111-134    20-46  (58)
377 COG4189 Predicted transcriptio  21.6      89  0.0019   26.4   2.7   18  111-128    39-56  (308)
378 PRK14704 anaerobic ribonucleos  21.6      49  0.0011   31.3   1.3   21    4-31    560-580 (618)
379 TIGR01565 homeo_ZF_HD homeobox  21.3      80  0.0017   20.4   1.9   17  110-126    33-49  (58)
380 PF12156 ATPase-cat_bd:  Putati  21.3      46   0.001   23.1   0.8   42    4-48      1-48  (88)
381 cd08313 Death_TNFR1 Death doma  21.2 1.2E+02  0.0026   20.8   2.9   20  109-128    11-30  (80)
382 PF05864 Chordopox_RPO7:  Chord  21.1      38 0.00083   22.0   0.4   13   23-35      4-16  (63)
383 PF04031 Las1:  Las1-like ;  In  21.1      81  0.0018   24.3   2.3   19  110-128   102-120 (154)
384 PHA03082 DNA-dependent RNA pol  21.0      38 0.00082   22.1   0.3   13   23-35      4-16  (63)
385 PF10668 Phage_terminase:  Phag  21.0 1.8E+02  0.0038   18.9   3.5   18  111-128    24-41  (60)
386 TIGR00201 comF comF family pro  21.0      42 0.00091   26.3   0.7   23    6-34      1-23  (190)
387 COG3364 Zn-ribbon containing p  20.8      44 0.00095   24.4   0.6   11   25-35      4-14  (112)
388 PHA02325 hypothetical protein   20.7      51  0.0011   21.9   0.9   11    1-11      1-11  (72)
389 PTZ00073 60S ribosomal protein  20.5      47   0.001   23.5   0.7   23    4-31     17-39  (91)
390 cd01407 SIR2-fam SIR2 family o  20.5      55  0.0012   26.3   1.3   39    3-41    109-151 (218)
391 PF06056 Terminase_5:  Putative  20.4      92   0.002   19.9   2.1   18  111-128    15-32  (58)
392 PLN03165 chaperone protein dna  20.4      58  0.0013   23.9   1.2    7    5-11     54-60  (111)
393 KOG0653 Cyclin B and related k  20.4 4.5E+02  0.0097   23.2   7.1   65  106-170   159-231 (391)
394 PF04032 Rpr2:  RNAse P Rpr2/Rp  20.2      52  0.0011   22.0   0.9   20   15-34     38-57  (85)
395 COG1545 Predicted nucleic-acid  20.1      88  0.0019   23.6   2.2   24    4-33     30-53  (140)
396 smart00547 ZnF_RBZ Zinc finger  20.1      49  0.0011   17.1   0.6   11   22-32      1-11  (26)
397 KOG0818 GTPase-activating prot  20.1      52  0.0011   30.6   1.1   29    4-32      9-37  (669)
398 PF04967 HTH_10:  HTH DNA bindi  20.0 1.9E+02  0.0041   18.2   3.4   18  111-128    25-42  (53)

No 1  
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=100.00  E-value=6.9e-45  Score=310.42  Aligned_cols=163  Identities=28%  Similarity=0.508  Sum_probs=145.0

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccccCCccccccccccccCCCCCCCccccCCCCccccCCCCceEEeCCC-C
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPTNPLLADGGLSTVIAKPN-G   81 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~~~Ewr~F~~~~~~~d~sr~G~p~~~~l~~~gl~T~i~~~~-~   81 (181)
                      ..+||+||+ +++++|+++|++||++||+||+|++||+|||||+|++++ .+|++|+|+|.++++||.|++|.|++++ +
T Consensus        11 ~~~Cp~Cg~-~~iv~d~~~Ge~vC~~CG~Vl~e~~iD~g~EWR~f~~~~-~~~~~RvG~~~~~~~~~~gl~T~I~~~~~~   88 (310)
T PRK00423         11 KLVCPECGS-DKLIYDYERGEIVCADCGLVIEENIIDQGPEWRAFDPEQ-REKRSRVGAPMTYTIHDKGLSTDIDWRNKD   88 (310)
T ss_pred             CCcCcCCCC-CCeeEECCCCeEeecccCCcccccccccCCCccCCCccc-cCCccccCCCCCccccCCCCceEeecCCcc
Confidence            367999998 789999999999999999999999999999999999875 5699999999999999999999999654 3


Q ss_pred             CCCcccc-------ccccccccCC---CCchHHHHHHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh-h----CHHHHH
Q 030241           82 ASGEFLS-------SSLGRWQNRG---SNPDRGLILAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE-I----KTHYWL  144 (181)
Q Consensus        82 ~~g~~l~-------~~l~~~q~~~---~~~er~l~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~-l----~~~~v~  144 (181)
                      ..|+.++       .+|++||++.   ++.||+|..|+++|++||+.|+||+.|+|+  .+|+++.++ +    +.++++
T Consensus        89 ~~g~~l~~~~~~~~~rl~~~~~~~~~~~~~er~l~~a~~~I~~~~~~L~Lp~~v~e~A~~iyk~~~~~~~~rgrs~~~i~  168 (310)
T PRK00423         89 SYGKSISGKNRAQLYRLRKWQRRIRVSNAAERNLAFALSELDRIASQLGLPRSVREEAAVIYRKAVEKGLIRGRSIEGVV  168 (310)
T ss_pred             cccccccHHHHHHHHHHHHHhhhcccCChHhHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhcCcccCCCHHHHH
Confidence            4555443       2488998875   678999999999999999999999999999  899999887 3    899999


Q ss_pred             HHHHHHHHHhCCCCcc--------ccChhhh
Q 030241          145 LACTLLVDKKTSHALL--------RVQPKIL  167 (181)
Q Consensus       145 AAclYiACR~~~~p~t--------~~~~~~~  167 (181)
                      |||||+|||++++|.|        .+.+|.+
T Consensus       169 AAclYiACR~~~~prtl~eI~~~~~v~~k~i  199 (310)
T PRK00423        169 AAALYAACRRCKVPRTLDEIAEVSRVSRKEI  199 (310)
T ss_pred             HHHHHHHHHHcCCCcCHHHHHHHhCCCHHHH
Confidence            9999999999999987        4666655


No 2  
>KOG1597 consensus Transcription initiation factor TFIIB [Transcription]
Probab=100.00  E-value=1.7e-42  Score=287.56  Aligned_cols=163  Identities=50%  Similarity=0.748  Sum_probs=147.9

Q ss_pred             CCCCCCCCCCc-eeEeCCCCceEeCCCccccccCCccccccccccccCCCCCCCccccCCCCccccCCCCceEEeCCCCC
Q 030241            4 AFCSDCKKHTE-VVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPTNPLLADGGLSTVIAKPNGA   82 (181)
Q Consensus         4 ~~Cp~Cg~~~~-iv~D~~~G~~vC~~CG~Vl~e~~id~~~Ewr~F~~~~~~~d~sr~G~p~~~~l~~~gl~T~i~~~~~~   82 (181)
                      ++||+|+.+++ +|+|+.+|++||.+||+|+++++||.++|||+|++++++.||+|||+|.||++.+.+|.|.|+.+.+.
T Consensus         1 ~~c~~C~~~~~~~V~d~~~gdtvC~~CGlVl~~r~Id~~sEwrtfsnd~~~~DPsrvG~~sNPlL~~g~L~T~I~~g~g~   80 (308)
T KOG1597|consen    1 MTCPDCKRHPENLVEDHSAGDTVCSECGLVLEDRIIDEGSEWRTFSNDDSDADPSRVGASSNPLLDGGDLSTFISKGTGT   80 (308)
T ss_pred             CCCCCCCCCCCCeeeeccCCceecccCCeeeccccccccccccccccCCCCCCccccCCCCCCCCCCCCcceeeecCCCC
Confidence            47999998777 99999999999999999999999999999999999987899999999999999999999999988765


Q ss_pred             CCccccccccccccC--CCCchHHHHHHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh--h---CHHHHHHHHHHHHHH
Q 030241           83 SGEFLSSSLGRWQNR--GSNPDRGLILAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE--I---KTHYWLLACTLLVDK  153 (181)
Q Consensus        83 ~g~~l~~~l~~~q~~--~~~~er~l~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~--l---~~~~v~AAclYiACR  153 (181)
                      ++..+ ..|.++|++  +++.|+.+..||++|..|+++|+||..|.|+  ++||++++.  +   +.++++|||||+|||
T Consensus        81 ~s~~~-s~l~~~Q~~~sm~~~d~~~~~a~~~I~~m~d~~~Lp~~I~d~A~~ifk~v~~~k~lrGks~eai~AAclyiACR  159 (308)
T KOG1597|consen   81 SSSFA-SSLGKAQNRNSMSNSDRVLKAAFKEITAMCDRLSLPATIKDRANEIFKLVEDSKLLRGKSVEALAAACLYIACR  159 (308)
T ss_pred             CHHHH-HHHHHHhcccccCCccHHHHHHHHHHHHHHHHhCCchHHHHHHHHHHHHHHHhhhhcCccHHHHHHHHHHHHHH
Confidence            54433 347788974  4789999999999999999999999999999  999999876  4   899999999999999


Q ss_pred             hCCCCcc--------ccChhhh
Q 030241          154 KTSHALL--------RVQPKIL  167 (181)
Q Consensus       154 ~~~~p~t--------~~~~~~~  167 (181)
                      +++.|.|        .||||+.
T Consensus       160 q~~~pRT~kEI~~~anv~kKEI  181 (308)
T KOG1597|consen  160 QEDVPRTFKEISAVANVSKKEI  181 (308)
T ss_pred             hcCCCchHHHHHHHHcCCHHHH
Confidence            9999987        6888874


No 3  
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=100.00  E-value=3.3e-37  Score=259.55  Aligned_cols=148  Identities=30%  Similarity=0.542  Sum_probs=132.9

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCCccccccccccccCCCCCCCccccCCCCccccCCCCceEEeCCCCCC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPTNPLLADGGLSTVIAKPNGAS   83 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~~~Ewr~F~~~~~~~d~sr~G~p~~~~l~~~gl~T~i~~~~~~~   83 (181)
                      +.||+||+ ++++.|++.|++||.+||+|++|+.||.|||||+| ++  ...+ |+|+|.++.+||.|++|.|+++... 
T Consensus         2 ~~CpeCg~-~~~~~d~~~ge~VC~~CG~Vi~~~~id~gpewr~f-~e--~~~~-r~g~P~t~~~~d~~l~t~i~~~~~~-   75 (285)
T COG1405           2 MSCPECGS-TNIITDYERGEIVCADCGLVLEDSLIDPGPEWRAF-DE--RHER-RVGAPLTPSIHDKGLSTIIGWGDKD-   75 (285)
T ss_pred             CCCCCCCC-ccceeeccCCeEEeccCCEEeccccccCCCCcccc-cc--cccc-cccCCCccccCccchhhhcccchhH-
Confidence            57999998 79999999999999999999999999999999999 33  2334 9999999999999999999876421 


Q ss_pred             CccccccccccccCC---CCchHHHHHHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh-h----CHHHHHHHHHHHHHH
Q 030241           84 GEFLSSSLGRWQNRG---SNPDRGLILAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE-I----KTHYWLLACTLLVDK  153 (181)
Q Consensus        84 g~~l~~~l~~~q~~~---~~~er~l~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~-l----~~~~v~AAclYiACR  153 (181)
                         ...+|++||.+.   +++||++..++.+|+.+++.|+||.+|.|+  .||+++.++ +    +.+.++|||+|+|||
T Consensus        76 ---~~~rlr~~~~~~~v~~~~ernl~~a~~~l~~~~~~l~LP~~v~e~A~~iyr~a~~~~l~rGRsie~v~AA~iY~acR  152 (285)
T COG1405          76 ---KMYRLRKWQIRIRVSSAKERNLITALEELERIASALGLPESVRETAARIYRKAVDKGLLRGRSIESVAAACIYAACR  152 (285)
T ss_pred             ---HHHHHHHHHhccccccchhhHHHHHHHHHHHHHHHhCCCchHHHHHHHHHHHHhhcCCCcCCcHHHHHHHHHHHHHH
Confidence               235688999754   579999999999999999999999999999  999999988 5    899999999999999


Q ss_pred             hCCCCcc
Q 030241          154 KTSHALL  160 (181)
Q Consensus       154 ~~~~p~t  160 (181)
                      +++.|.|
T Consensus       153 ~~~~prt  159 (285)
T COG1405         153 INGVPRT  159 (285)
T ss_pred             HcCCCcc
Confidence            9999987


No 4  
>KOG1598 consensus Transcription initiation factor TFIIIB, Brf1 subunit [Transcription]
Probab=99.78  E-value=4.9e-19  Score=157.51  Aligned_cols=121  Identities=19%  Similarity=0.338  Sum_probs=99.3

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCCccccccccccccCCCCCCCccccCCCCccccCCCCceEEeCCCCCC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPTNPLLADGGLSTVIAKPNGAS   83 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~~~Ewr~F~~~~~~~d~sr~G~p~~~~l~~~gl~T~i~~~~~~~   83 (181)
                      +.|++||+ +++..|..+|+.+|+.||.|+|+++|+.+.   +|...           +         .|+.|+....+.
T Consensus         1 ~~C~~C~~-s~fe~d~a~g~~~C~~CG~v~E~~~ivsev---~F~e~-----------~---------~G~~v~~~~~g~   56 (521)
T KOG1598|consen    1 MVCKNCGG-SNFERDEATGNLYCTACGTVLEYNNIVAEV---TFVEG-----------A---------QGQFVRVGQSGA   56 (521)
T ss_pred             CcCCCCCC-CCcccccccCCceeccccceeeccceeEEe---eeecc-----------c---------ceeEEeccccCC
Confidence            47999998 899999999999999999999999999754   46522           1         134554322111


Q ss_pred             CccccccccccccCCCCchHHHHHHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh-h----CHHHHHHHHHHHHHHhCC
Q 030241           84 GEFLSSSLGRWQNRGSNPDRGLILAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE-I----KTHYWLLACTLLVDKKTS  156 (181)
Q Consensus        84 g~~l~~~l~~~q~~~~~~er~l~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~-l----~~~~v~AAclYiACR~~~  156 (181)
                      +.           ..+++++++++|++.|++++.+|+|+. ++|.  .+|++|.++ |    +...|+|||+|++||+++
T Consensus        57 ~~-----------s~e~r~~t~~n~r~~i~~~~~~l~l~~-~~~~a~~~~k~a~~~nftkGr~~~~vvasClY~vcR~e~  124 (521)
T KOG1598|consen   57 GS-----------SLESREKTIYNARRLIEELTERLNLGN-KTEVAFNFFKLAPDRNFTKGRRSTEVVAACLYLVCRLEK  124 (521)
T ss_pred             cc-----------chHHHHHHHHHHHhHHHHHHHhcCcch-HHHHHHHHHHHHhhCCCCCCcchHHHHHHHHHHHHHhhC
Confidence            10           116889999999999999999999999 8888  999999999 7    899999999999999999


Q ss_pred             CCcc
Q 030241          157 HALL  160 (181)
Q Consensus       157 ~p~t  160 (181)
                      ++..
T Consensus       125 t~hl  128 (521)
T KOG1598|consen  125 TDHL  128 (521)
T ss_pred             CceE
Confidence            9953


No 5  
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=99.70  E-value=7.2e-18  Score=104.15  Aligned_cols=43  Identities=51%  Similarity=1.076  Sum_probs=38.8

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCCcccccccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTF   47 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~~~Ewr~F   47 (181)
                      ++||+||+ +.+++|+.+|++||++||+||+|+.|++++|||+|
T Consensus         1 m~Cp~Cg~-~~~~~D~~~g~~vC~~CG~Vl~e~~i~~~~e~r~f   43 (43)
T PF08271_consen    1 MKCPNCGS-KEIVFDPERGELVCPNCGLVLEENIIDEGPEWREF   43 (43)
T ss_dssp             ESBTTTSS-SEEEEETTTTEEEETTT-BBEE-TTBSCCCSCCHC
T ss_pred             CCCcCCcC-CceEEcCCCCeEECCCCCCEeecccccCCcccccC
Confidence            47999998 67999999999999999999999999999999987


No 6  
>PF00382 TFIIB:  Transcription factor TFIIB repeat;  InterPro: IPR013150 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs). Cyclins, together with the p34 (cdc2) or cdk2 kinases, form the Maturation Promoting Factor (MPF). There are two main groups of cyclins, G1/S cyclins, which are essential for the control of the cell cycle at the G1/S (start) transition, and G2/M cyclins, which are essential for the control of the cell cycle at the G2/M (mitosis) transition. G2/M cyclins accumulate steadily during G2 and are abruptly destroyed as cells exit from mitosis (at the end of the M-phase). In most species, there are multiple forms of G1 and G2 cyclins. For example, in vertebrates, there are two G2 cyclins, A and B, and at least three G1 cyclins, C, D, and E. Cyclin homologues have been found in various viruses, including Saimiriine herpesvirus 2 (Herpesvirus saimiri) and Human herpesvirus 8 (HHV-8) (Kaposi's sarcoma-associated herpesvirus). These viral homologues differ from their cellular counterparts in that the viral proteins have gained new functions and eliminated others to harness the cell and benefit the virus []. In eukaryotes, transcription initiation of all protein encoding genes involves the polymerase II system. This sytem is modulated by both general and specific transcription factors. The general factors (which include TFIIA, TFIIB, TFIID, TFIIE, TFIIF, TFIIG and TFIIH) operate through common promoter elements, such as the TATA box. Transcription factor IIB (TFIIB) is of central importance in transcription of class II genes. It associates with TFIID-TFIIA bound to DNA (the DA complex) to form a ternary TFIID-IIA-IBB (DAB) complex, which is recognised by RNA polymerase II [, ]. TFIIB comprises ~315-340 residues and contains an imperfect C-terminal repeat of a 75-residue domain that may contribute to the symmetry of the folded protein. The basal archaeal transcription machinery resembles that of the eukaryotic polymerase II system and includes a homologue of TFIIB []. This entry represents a cyclin-like domain which is found repeated in the C-terminal region of a variety of eukaryotic TFIIB's and their archaeal counterparts. These domains individually form the typical cyclin fold, and in the transcription complex they straddle the C-terminal region of the TATA-binding protein - an interaction essential for the formation of the transcription initiation complex [, ].; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2PHG_A 1C9B_Q 1TFB_A 1VOL_A 3K7A_M 1AIS_B 1D3U_B.
Probab=99.33  E-value=4.3e-12  Score=85.98  Aligned_cols=49  Identities=14%  Similarity=0.210  Sum_probs=43.2

Q ss_pred             HHHHHHHhCCchHHHHH--HHHHHHHhh-h----CHHHHHHHHHHHHHHhCCCCcc
Q 030241          112 IATMSDRIGQMRYIRRW--KIKSLVEAE-I----KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       112 I~~ia~~L~Lp~~v~e~--~i~k~a~~~-l----~~~~v~AAclYiACR~~~~p~t  160 (181)
                      |++||++|+||++|+++  ++|+++.+. +    ++..++|||||+|||+++.|+|
T Consensus         1 I~r~~~~L~L~~~v~~~A~~i~~~~~~~~~~~Gr~~~~iaAA~iY~acr~~~~~~t   56 (71)
T PF00382_consen    1 IPRICSKLGLPEDVRERAKEIYKKAQERGLLKGRSPESIAAACIYLACRLNGVPRT   56 (71)
T ss_dssp             HHHHHHHTT--HHHHHHHHHHHHHHHHTTTSTTS-HHHHHHHHHHHHHHHTTSSSS
T ss_pred             ChHHHhHcCCCHHHHHHHHHHHHHHHHcCCcccCCHHHHHHHHHHHHHHHcCCCcC
Confidence            68999999999999999  999999877 4    7899999999999999999987


No 7  
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=98.35  E-value=1.2e-06  Score=75.17  Aligned_cols=53  Identities=6%  Similarity=0.054  Sum_probs=48.4

Q ss_pred             HHHHHHHHHHHhCCchHHHHH--HHHHHHHhh-h----CHHHHHHHHHHHHHHhCCCCcc
Q 030241          108 AFKTIATMSDRIGQMRYIRRW--KIKSLVEAE-I----KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       108 a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~-l----~~~~v~AAclYiACR~~~~p~t  160 (181)
                      ....|.++|++|+||..+.++  +|++++.+. +    ++..++|||||+|||.++.|.|
T Consensus       219 p~~~i~r~~~~L~L~~~v~~~A~~i~~~a~~~~l~~Gr~P~sIAAAaIYlA~~~~g~~~t  278 (310)
T PRK00423        219 PIDYVPRFASELGLSGEVQKKAIEILQKAKEKGLTSGKGPTGLAAAAIYIASLLLGERRT  278 (310)
T ss_pred             HHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhcCcccCCCHHHHHHHHHHHHHHHhCCCCC
Confidence            457889999999999999999  899999776 4    8999999999999999999976


No 8  
>cd00043 CYCLIN Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.
Probab=97.99  E-value=4.1e-05  Score=51.55  Aligned_cols=54  Identities=7%  Similarity=0.014  Sum_probs=47.1

Q ss_pred             HHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh--h---CHHHHHHHHHHHHHHhCCCCcc
Q 030241          107 LAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE--I---KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       107 ~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~--l---~~~~v~AAclYiACR~~~~p~t  160 (181)
                      .+++.|.+++..+++|..+...  .++.++...  +   +...+++||||+||+.++.|.+
T Consensus         4 ~~~~~l~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~ia~a~l~lA~k~~~~~~~   64 (88)
T cd00043           4 TPLDFLRRVAKALGLSPETLTLAVNLLDRFLLDYSVLGRSPSLVAAAALYLAAKVEEIPPW   64 (88)
T ss_pred             hHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHhcccccCChHHHHHHHHHHHHHHcCCCCC
Confidence            4778999999999999999888  788888655  3   8999999999999999998654


No 9  
>smart00385 CYCLIN domain present in cyclins, TFIIB and Retinoblastoma. A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.
Probab=97.89  E-value=5.4e-05  Score=50.48  Aligned_cols=50  Identities=6%  Similarity=-0.068  Sum_probs=43.0

Q ss_pred             HHHHHHHHhCCchHHHHH--HHHHHHHh-h-h---CHHHHHHHHHHHHHHhCCCCcc
Q 030241          111 TIATMSDRIGQMRYIRRW--KIKSLVEA-E-I---KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       111 ~I~~ia~~L~Lp~~v~e~--~i~k~a~~-~-l---~~~~v~AAclYiACR~~~~p~t  160 (181)
                      .|.+++..+++|+.+...  .+++.+.. . +   +...++|||||+|||.++.+.+
T Consensus         2 ~l~~~~~~~~~~~~~~~~a~~~~~~~l~~~~~~~~~~~~ia~a~l~lA~k~~~~~~~   58 (83)
T smart00385        2 FLRRVCKALNLDPETLNLAVNLLDRFLSDYKFLKYSPSLIAAAALYLAAKTEEIPPW   58 (83)
T ss_pred             HHHHHHHHcCCCHHHHHHHHHHHHHHHHHhhcccCCHHHHHHHHHHHHHHHhcCCCC
Confidence            478899999999999888  78888865 3 3   8999999999999999998743


No 10 
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=97.80  E-value=5.1e-05  Score=64.51  Aligned_cols=54  Identities=13%  Similarity=0.064  Sum_probs=48.1

Q ss_pred             HHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh-h----CHHHHHHHHHHHHHHhCCCCcc
Q 030241          107 LAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE-I----KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       107 ~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~-l----~~~~v~AAclYiACR~~~~p~t  160 (181)
                      +-..+|.++|+.||||+.|...  ++.+++.+. +    +...++|||||+|+++++.+.|
T Consensus       193 ~p~~yi~rf~s~L~l~~~v~~~a~ei~~~~~~~g~~~Gk~P~glAaaaiy~as~l~~~~~t  253 (285)
T COG1405         193 DPSDYIPRFASKLGLSDEVRRKAIEIVKKAKRAGLTAGKSPAGLAAAAIYLASLLLGERRT  253 (285)
T ss_pred             CHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHhCcccCCCchhHHHHHHHHHHHHhCCchH
Confidence            4567899999999999888777  899999877 4    8999999999999999998876


No 11 
>KOG1597 consensus Transcription initiation factor TFIIB [Transcription]
Probab=97.26  E-value=0.00083  Score=56.96  Aligned_cols=53  Identities=9%  Similarity=0.063  Sum_probs=47.4

Q ss_pred             HHHHHHHHHHHhCCchHHHHH--HHHHHHHhh-h----CHHHHHHHHHHHHHHhCCCCcc
Q 030241          108 AFKTIATMSDRIGQMRYIRRW--KIKSLVEAE-I----KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       108 a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~-l----~~~~v~AAclYiACR~~~~p~t  160 (181)
                      .-..|.++|+.|+||..+++.  ++-+++.+. +    ++-.++||.||++++....+.|
T Consensus       203 t~~~m~RFCs~L~L~~~~q~aA~e~a~ka~~~~~~~gRsPiSIAAa~IYmisqls~~kkt  262 (308)
T KOG1597|consen  203 TGDFMPRFCSNLGLPKSAQEAATEIAEKAEEMDIRAGRSPISIAAAAIYMISQLSDEKKT  262 (308)
T ss_pred             HHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHhccccCCCchhHHHHHHHHHHHhccCccc
Confidence            567889999999999999999  899999887 4    8899999999999999887755


No 12 
>PF01857 RB_B:  Retinoblastoma-associated protein B domain;  InterPro: IPR002719 Retinoblastoma-like and retinoblastoma-associated proteins may have a function in cell cycle regulation. They form a complex with adenovirus E1A and SV40 large T antigen, and may bind and modulate the function of certain cellular proteins with which T and E1A compete for pocket binding. The proteins may act as tumor suppressors, and are potent inhibitors of E2F-mediated trans-activation. This domain has the cyclin fold [].  The crystal structure of the Rb pocket bound to a nine-residue E7 peptide containing the LxCxE motif, shared by other Rb-binding viral and cellular proteins, shows that the LxCxE peptide binds a highly conserved groove on the B-box portion of the pocket; the A-box portion (see IPR002720 from INTERPRO) appears to be required for the stable folding of the B box. Also highly conserved is the extensive A-B interface, suggesting that it may be an additional protein-binding site. The A and B boxes each contain the cyclin-fold structural motif, with the LxCxE-binding site on the B-box cyclin fold being similar to a Cdk2-binding site of cyclin A and to a TBP-binding site of TFIIB [].  The A and B boxes are found at the C-terminal end of the protein; the B-box is on C-terminal side of the A-box.; GO: 0051726 regulation of cell cycle, 0005634 nucleus; PDB: 1GUX_B 3POM_A 1GH6_B 1N4M_A 1O9K_H 4ELL_B 2R7G_C 4ELJ_A.
Probab=97.26  E-value=0.0018  Score=49.31  Aligned_cols=57  Identities=12%  Similarity=0.057  Sum_probs=45.8

Q ss_pred             HHHHHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh---h----CHHHHHHHHHHHHHHhCCCCcc
Q 030241          104 GLILAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE---I----KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       104 ~l~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~---l----~~~~v~AAclYiACR~~~~p~t  160 (181)
                      .+.-|..+|+++|++|+|++.+.+.  .+|+.+...   |    ..+.++..|+|+.||.++.++|
T Consensus        10 vy~la~~Rl~~LC~~L~l~~~~~~~iwt~fe~~l~~~t~L~~dRHLDQiilCaiY~i~Kv~~~~~s   75 (135)
T PF01857_consen   10 VYKLAAVRLQDLCERLDLSSDLREKIWTCFEHSLTHHTELMKDRHLDQIILCAIYGICKVSKEELS   75 (135)
T ss_dssp             HHHHHHHHHHHHHHHHTTSTTHHHHHHHHHHHHHHHSGGGGTTS-HHHHHHHHHHHHHHHTT-S--
T ss_pred             HHHHHHHHHHHHHHHcCCcHHHHHHHHHHHHHHHHhhHHHHhcchHHHHHHHHHHHHHHhhcCCCC
Confidence            3455889999999999999999888  788876543   3    7899999999999999998876


No 13 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=97.10  E-value=0.00038  Score=41.11  Aligned_cols=28  Identities=29%  Similarity=0.534  Sum_probs=23.7

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ..|+.|++ .  .+...+|..+|..||.|++
T Consensus         9 ~~C~~C~~-~--~~~~~dG~~yC~~cG~~~E   36 (36)
T PF11781_consen    9 EPCPVCGS-R--WFYSDDGFYYCDRCGHQSE   36 (36)
T ss_pred             CcCCCCCC-e--EeEccCCEEEhhhCceEcC
Confidence            34999997 3  6778899999999999874


No 14 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=96.94  E-value=0.00084  Score=38.90  Aligned_cols=31  Identities=23%  Similarity=0.451  Sum_probs=25.6

Q ss_pred             CCCCCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            1 MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         1 m~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      |....|+.||.  +.++..+++..+|.+||.+.
T Consensus         1 ~~~~~C~~C~~--~~i~~~~~~~~~C~~Cg~~~   31 (33)
T PF08792_consen    1 SNLKKCSKCGG--NGIVNKEDDYEVCIFCGSSF   31 (33)
T ss_pred             CCceEcCCCCC--CeEEEecCCeEEcccCCcEe
Confidence            55678999996  45666789999999999875


No 15 
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=96.91  E-value=0.00055  Score=44.71  Aligned_cols=31  Identities=35%  Similarity=0.757  Sum_probs=28.3

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLES   35 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e   35 (181)
                      .+||+|+. ..+||++++-.+.|..||.+|.+
T Consensus        12 VkCp~C~n-~q~vFsha~t~V~C~~Cg~~L~~   42 (59)
T PRK00415         12 VKCPDCGN-EQVVFSHASTVVRCLVCGKTLAE   42 (59)
T ss_pred             EECCCCCC-eEEEEecCCcEEECcccCCCccc
Confidence            57999997 78999999999999999999953


No 16 
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=96.87  E-value=0.00058  Score=45.46  Aligned_cols=31  Identities=35%  Similarity=0.778  Sum_probs=28.2

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLES   35 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e   35 (181)
                      .+||+|+. ..++|++.+-.+.|..||.+|-+
T Consensus        20 VkCpdC~N-~q~vFshast~V~C~~CG~~l~~   50 (67)
T COG2051          20 VKCPDCGN-EQVVFSHASTVVTCLICGTTLAE   50 (67)
T ss_pred             EECCCCCC-EEEEeccCceEEEecccccEEEe
Confidence            57999997 78999999999999999999853


No 17 
>PF01667 Ribosomal_S27e:  Ribosomal protein S27;  InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families include mammalian, yeast, Chlamydomonas reinhardtii and Entamoeba histolytica S27, and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0250 []. These proteins have from 62 to 87 amino acids. They contain, in their central section, a putative zinc-finger region of the type C-x(2)-C-x(14)-C-x(2)-C.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1QXF_A 3IZ6_X 2XZN_6 2XZM_6 3U5G_b 3IZB_X 3U5C_b.
Probab=96.81  E-value=0.00047  Score=44.51  Aligned_cols=30  Identities=33%  Similarity=0.722  Sum_probs=23.0

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .+||.|+. ..+|+++++-.+.|..||.+|-
T Consensus         8 VkCp~C~~-~q~vFSha~t~V~C~~Cg~~L~   37 (55)
T PF01667_consen    8 VKCPGCYN-IQTVFSHAQTVVKCVVCGTVLA   37 (55)
T ss_dssp             EE-TTT-S-EEEEETT-SS-EE-SSSTSEEE
T ss_pred             EECCCCCC-eeEEEecCCeEEEcccCCCEec
Confidence            67999997 7899999999999999999995


No 18 
>PHA00626 hypothetical protein
Probab=96.72  E-value=0.0014  Score=42.19  Aligned_cols=31  Identities=23%  Similarity=0.570  Sum_probs=23.7

Q ss_pred             CCCCCCCCCCceeEeC----CCCceEeCCCcccccc
Q 030241            4 AFCSDCKKHTEVVFDH----SAGDTVCSECGLVLES   35 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~----~~G~~vC~~CG~Vl~e   35 (181)
                      +.||.||+ .+++...    .+..++|.+||+-...
T Consensus         1 m~CP~CGS-~~Ivrcg~cr~~snrYkCkdCGY~ft~   35 (59)
T PHA00626          1 MSCPKCGS-GNIAKEKTMRGWSDDYVCCDCGYNDSK   35 (59)
T ss_pred             CCCCCCCC-ceeeeeceecccCcceEcCCCCCeech
Confidence            46999998 5666532    3689999999998643


No 19 
>TIGR00569 ccl1 cyclin ccl1. University).
Probab=96.66  E-value=0.007  Score=52.01  Aligned_cols=59  Identities=10%  Similarity=0.046  Sum_probs=49.6

Q ss_pred             hHHH-HHHHHHHHHHHHHhC--CchHHHHH--HHHHHHHhh--h---CHHHHHHHHHHHHHHhCCCCcc
Q 030241          102 DRGL-ILAFKTIATMSDRIG--QMRYIRRW--KIKSLVEAE--I---KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       102 er~l-~~a~~~I~~ia~~L~--Lp~~v~e~--~i~k~a~~~--l---~~~~v~AAclYiACR~~~~p~t  160 (181)
                      |+.| ...-..|.++|..|+  ||+.|+-+  .+|+...-+  +   ....+++||||+||+.+..|++
T Consensus        52 E~~l~~~y~~~i~~~~~~lkp~Lpq~viaTAivyf~RFy~~~Sv~~~~p~~Ia~tclfLA~KvEE~~~s  120 (305)
T TIGR00569        52 ELDLVKYYEKRLLDFCSAFKPTMPTSVVGTAIMYFKRFYLNNSVMEYHPKIIMLTCVFLACKVEEFNVS  120 (305)
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCCCchHHHHHHHHHhHHhccCchhhcCHHHHHHHHHHHHHhccccCcC
Confidence            5555 447789999999999  99999999  788876443  4   8999999999999999999874


No 20 
>PLN00209 ribosomal protein S27; Provisional
Probab=96.35  E-value=0.002  Score=45.05  Aligned_cols=31  Identities=35%  Similarity=0.657  Sum_probs=28.3

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLES   35 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e   35 (181)
                      .+||.|+. ..+||++++-.+.|..||.+|-+
T Consensus        37 VkCp~C~n-~q~VFShA~t~V~C~~Cg~~L~~   67 (86)
T PLN00209         37 VKCQGCFN-ITTVFSHSQTVVVCGSCQTVLCQ   67 (86)
T ss_pred             EECCCCCC-eeEEEecCceEEEccccCCEeec
Confidence            57999997 78999999999999999999953


No 21 
>PTZ00083 40S ribosomal protein S27; Provisional
Probab=96.27  E-value=0.0024  Score=44.55  Aligned_cols=31  Identities=26%  Similarity=0.618  Sum_probs=28.3

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLES   35 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e   35 (181)
                      .+||.|+. ..+||++++-.+.|..||.+|-+
T Consensus        36 VkCp~C~n-~q~VFShA~t~V~C~~Cg~~L~~   66 (85)
T PTZ00083         36 VKCPGCSQ-ITTVFSHAQTVVLCGGCSSQLCQ   66 (85)
T ss_pred             EECCCCCC-eeEEEecCceEEEccccCCEeec
Confidence            57999997 68999999999999999999953


No 22 
>COG5333 CCL1 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]
Probab=96.27  E-value=0.0046  Score=52.68  Aligned_cols=53  Identities=15%  Similarity=0.101  Sum_probs=46.4

Q ss_pred             HHHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh--h---CHHHHHHHHHHHHHHhCCCC
Q 030241          106 ILAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE--I---KTHYWLLACTLLVDKKTSHA  158 (181)
Q Consensus       106 ~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~--l---~~~~v~AAclYiACR~~~~p  158 (181)
                      ..++..|..+|.+|+||..+.++  .+|++..-+  +   +...++++|||+||+-+..|
T Consensus        46 i~~~k~i~~l~~~L~lp~~~laTAi~~f~Rf~Lk~sv~e~~~~~vv~tcv~LA~K~ed~~  105 (297)
T COG5333          46 IYYLKLIMDLCTRLNLPQTVLATAILFFSRFYLKNSVEEISLYSVVTTCVYLACKVEDTP  105 (297)
T ss_pred             HHHHHHHHHHHHhcCCCcchHHHHHHHHHHHHhhcccccccHHHHHHhheeeeeeccccc
Confidence            55789999999999999999999  788876444  3   89999999999999999965


No 23 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=96.12  E-value=0.0031  Score=34.41  Aligned_cols=22  Identities=27%  Similarity=0.967  Sum_probs=17.6

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGL   31 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~   31 (181)
                      +.||+||. . +    +.+..+|..||.
T Consensus         3 ~~Cp~Cg~-~-~----~~~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGA-E-I----DPDAKFCPNCGA   24 (26)
T ss_pred             CCCcccCC-c-C----CcccccChhhCC
Confidence            78999996 2 2    357899999996


No 24 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=96.04  E-value=0.0051  Score=37.97  Aligned_cols=31  Identities=29%  Similarity=0.682  Sum_probs=25.3

Q ss_pred             CCCCCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            1 MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         1 m~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      |...+||+||.  .+.+|+..+...|..||.-+
T Consensus         1 ~~~y~C~~CG~--~~~~~~~~~~~~Cp~CG~~~   31 (46)
T PRK00398          1 MAEYKCARCGR--EVELDEYGTGVRCPYCGYRI   31 (46)
T ss_pred             CCEEECCCCCC--EEEECCCCCceECCCCCCeE
Confidence            55678999996  57788877799999999644


No 25 
>PRK00420 hypothetical protein; Validated
Probab=96.02  E-value=0.005  Score=45.41  Aligned_cols=31  Identities=29%  Similarity=0.600  Sum_probs=24.0

Q ss_pred             CCCCCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            1 MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         1 m~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      |-...||.||.  ++ +-..+|..+|..||.++.
T Consensus        21 ml~~~CP~Cg~--pL-f~lk~g~~~Cp~Cg~~~~   51 (112)
T PRK00420         21 MLSKHCPVCGL--PL-FELKDGEVVCPVHGKVYI   51 (112)
T ss_pred             HccCCCCCCCC--cc-eecCCCceECCCCCCeee
Confidence            33467999996  34 444899999999999873


No 26 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=96.01  E-value=0.0033  Score=33.42  Aligned_cols=22  Identities=23%  Similarity=0.915  Sum_probs=16.9

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      +||+||..  +    ..+..+|..||.-
T Consensus         1 ~Cp~CG~~--~----~~~~~fC~~CG~~   22 (23)
T PF13240_consen    1 YCPNCGAE--I----EDDAKFCPNCGTP   22 (23)
T ss_pred             CCcccCCC--C----CCcCcchhhhCCc
Confidence            59999972  2    2467899999974


No 27 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=95.74  E-value=0.0064  Score=35.42  Aligned_cols=26  Identities=27%  Similarity=0.779  Sum_probs=15.4

Q ss_pred             CCCCCCCCCceeEe----CCCCceEeCCCccc
Q 030241            5 FCSDCKKHTEVVFD----HSAGDTVCSECGLV   32 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D----~~~G~~vC~~CG~V   32 (181)
                      +||.||..  +...    ...--.||+.||.|
T Consensus         2 fC~~CG~~--l~~~ip~gd~r~R~vC~~Cg~I   31 (34)
T PF14803_consen    2 FCPQCGGP--LERRIPEGDDRERLVCPACGFI   31 (34)
T ss_dssp             B-TTT--B---EEE--TT-SS-EEEETTTTEE
T ss_pred             ccccccCh--hhhhcCCCCCccceECCCCCCE
Confidence            69999973  4443    34556899999998


No 28 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=95.60  E-value=0.0057  Score=46.21  Aligned_cols=27  Identities=26%  Similarity=0.803  Sum_probs=21.0

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCc-ccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECG-LVL   33 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG-~Vl   33 (181)
                      ...||.||.  ++ |- .+|+++|..|| .+.
T Consensus        28 ~~hCp~Cg~--PL-F~-KdG~v~CPvC~~~~~   55 (131)
T COG1645          28 AKHCPKCGT--PL-FR-KDGEVFCPVCGYREV   55 (131)
T ss_pred             HhhCcccCC--cc-ee-eCCeEECCCCCceEE
Confidence            457999997  34 33 89999999999 443


No 29 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=95.59  E-value=0.01  Score=34.69  Aligned_cols=30  Identities=20%  Similarity=0.533  Sum_probs=19.2

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ..||+||+ --+......+...|..||++.+
T Consensus         2 ~FCp~C~n-lL~p~~~~~~~~~C~~C~Y~~~   31 (35)
T PF02150_consen    2 RFCPECGN-LLYPKEDKEKRVACRTCGYEEP   31 (35)
T ss_dssp             -BETTTTS-BEEEEEETTTTEEESSSS-EEE
T ss_pred             eeCCCCCc-cceEcCCCccCcCCCCCCCccC
Confidence            57999997 3333333455557999999864


No 30 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=95.50  E-value=0.011  Score=33.41  Aligned_cols=27  Identities=30%  Similarity=0.485  Sum_probs=14.7

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      -+||.|++ .....|  ...+||.+||.-.
T Consensus         3 p~Cp~C~s-e~~y~D--~~~~vCp~C~~ew   29 (30)
T PF08274_consen    3 PKCPLCGS-EYTYED--GELLVCPECGHEW   29 (30)
T ss_dssp             ---TTT------EE---SSSEEETTTTEEE
T ss_pred             CCCCCCCC-cceecc--CCEEeCCcccccC
Confidence            47999998 444444  7889999999643


No 31 
>KOG0834 consensus CDK9 kinase-activating protein cyclin T [Cell cycle control, cell division, chromosome partitioning]
Probab=95.40  E-value=0.032  Score=48.35  Aligned_cols=55  Identities=13%  Similarity=-0.055  Sum_probs=45.6

Q ss_pred             HHHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh--h---CHHHHHHHHHHHHHHhCCCCcc
Q 030241          106 ILAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE--I---KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       106 ~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~--l---~~~~v~AAclYiACR~~~~p~t  160 (181)
                      .++.+-|.+++.+|++|..-+.+  .+|....-.  |   ....+++||||+|++.++.|+.
T Consensus        40 ~~~~~fI~elg~~L~~~~~ti~tA~~~~hRFy~~~s~~~~~~~~vA~sclfLAgKvEetp~k  101 (323)
T KOG0834|consen   40 QEGAKFIQELGVRLKMPQKTIATAIVIFHRFYMFHSFKKFDPYTVAASCLFLAGKVEETPRK  101 (323)
T ss_pred             HHHHHHHHHHHHHcCCCccchhhhhhhhhhhhhhcccccCcHHHHHHHHHHHHhhcccCccc
Confidence            66999999999999999876666  677665443  4   5678999999999999999964


No 32 
>PF00134 Cyclin_N:  Cyclin, N-terminal domain;  InterPro: IPR006671 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs). Cyclins, together with the p34 (cdc2) or cdk2 kinases, form the Maturation Promoting Factor (MPF). There are two main groups of cyclins, G1/S cyclins, which are essential for the control of the cell cycle at the G1/S (start) transition, and G2/M cyclins, which are essential for the control of the cell cycle at the G2/M (mitosis) transition. G2/M cyclins accumulate steadily during G2 and are abruptly destroyed as cells exit from mitosis (at the end of the M-phase). In most species, there are multiple forms of G1 and G2 cyclins. For example, in vertebrates, there are two G2 cyclins, A and B, and at least three G1 cyclins, C, D, and E. Cyclin homologues have been found in various viruses, including Saimiriine herpesvirus 2 (Herpesvirus saimiri) and Human herpesvirus 8 (HHV-8) (Kaposi's sarcoma-associated herpesvirus). These viral homologues differ from their cellular counterparts in that the viral proteins have gained new functions and eliminated others to harness the cell and benefit the virus []. Cyclins contain two domains of similar all-alpha fold, of which this entry is associated with the N-terminal domain.; PDB: 2W2H_B 3RGF_B 1KXU_A 1JKW_A 1URC_D 2WMB_D 1H26_D 1GY3_B 2UUE_D 1E9H_D ....
Probab=95.35  E-value=0.055  Score=39.30  Aligned_cols=53  Identities=15%  Similarity=0.151  Sum_probs=43.5

Q ss_pred             HHHHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh--h---CHHHHHHHHHHHHHHhCCC
Q 030241          105 LILAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE--I---KTHYWLLACTLLVDKKTSH  157 (181)
Q Consensus       105 l~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~--l---~~~~v~AAclYiACR~~~~  157 (181)
                      -....+.|.+++..++++..+.-.  .++......  +   +...+++||+++||+.+..
T Consensus        31 r~~~~~~i~~~~~~~~l~~~~~~~A~~~~dr~~~~~~~~~~~~~li~~~cl~lA~K~~e~   90 (127)
T PF00134_consen   31 RQIIIDWIIELCQRLKLSPETLHLAIYLFDRFLSKRPVNRSKLQLIALACLFLASKMEED   90 (127)
T ss_dssp             HHHHHHHHHHHHHHTT-BHHHHHHHHHHHHHHHTTS-TTCCGHHHHHHHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHHHHhcccchhHHHHHHHHHHHHHhhcccccchhhhhhhhHHHHhhhhhcc
Confidence            356888999999999999998777  677776555  3   7889999999999999876


No 33 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=95.23  E-value=0.013  Score=36.99  Aligned_cols=27  Identities=26%  Similarity=0.695  Sum_probs=21.3

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      ..||.||+ . +..++. +...|..||+..
T Consensus        21 ~fCP~Cg~-~-~m~~~~-~r~~C~~Cgyt~   47 (50)
T PRK00432         21 KFCPRCGS-G-FMAEHL-DRWHCGKCGYTE   47 (50)
T ss_pred             CcCcCCCc-c-hheccC-CcEECCCcCCEE
Confidence            57999997 5 555544 899999999864


No 34 
>PRK11827 hypothetical protein; Provisional
Probab=95.11  E-value=0.017  Score=37.89  Aligned_cols=28  Identities=14%  Similarity=0.494  Sum_probs=24.3

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      ..||.|+.  .+..|....+++|..||++.
T Consensus         9 LaCP~ckg--~L~~~~~~~~Lic~~~~laY   36 (60)
T PRK11827          9 IACPVCNG--KLWYNQEKQELICKLDNLAF   36 (60)
T ss_pred             eECCCCCC--cCeEcCCCCeEECCccCeec
Confidence            56999986  57888888899999999986


No 35 
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=94.86  E-value=0.025  Score=33.56  Aligned_cols=29  Identities=31%  Similarity=0.720  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCCceeEeC--CCCceEeCCCcc
Q 030241            3 DAFCSDCKKHTEVVFDH--SAGDTVCSECGL   31 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~--~~G~~vC~~CG~   31 (181)
                      ..-||.||+....-+|.  .+|..+|..||.
T Consensus         3 ~~pCP~CGG~DrFr~~d~~g~G~~~C~~Cg~   33 (37)
T smart00778        3 HGPCPNCGGSDRFRFDDKDGRGTWFCSVCGA   33 (37)
T ss_pred             ccCCCCCCCccccccccCCCCcCEEeCCCCC
Confidence            35699999854455555  559999999984


No 36 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=94.68  E-value=0.03  Score=39.36  Aligned_cols=29  Identities=28%  Similarity=0.568  Sum_probs=25.3

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      ...||.||+ + .+.-..+|-..|..||.++
T Consensus        35 ~~~Cp~C~~-~-~VkR~a~GIW~C~kCg~~f   63 (89)
T COG1997          35 KHVCPFCGR-T-TVKRIATGIWKCRKCGAKF   63 (89)
T ss_pred             CCcCCCCCC-c-ceeeeccCeEEcCCCCCee
Confidence            356999998 4 6788899999999999986


No 37 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=94.57  E-value=0.019  Score=31.43  Aligned_cols=24  Identities=29%  Similarity=0.833  Sum_probs=18.5

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .||+|+..  |    ......|..||+++.
T Consensus         2 ~CP~C~~~--V----~~~~~~Cp~CG~~F~   25 (26)
T PF10571_consen    2 TCPECGAE--V----PESAKFCPHCGYDFE   25 (26)
T ss_pred             cCCCCcCC--c----hhhcCcCCCCCCCCc
Confidence            69999972  2    346789999999863


No 38 
>PRK10220 hypothetical protein; Provisional
Probab=94.43  E-value=0.098  Score=38.26  Aligned_cols=30  Identities=27%  Similarity=0.569  Sum_probs=22.3

Q ss_pred             CCCCCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            1 MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         1 m~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      |+.-.||.|++ .....|  ...+||.+||.--
T Consensus         1 m~lP~CP~C~s-eytY~d--~~~~vCpeC~hEW   30 (111)
T PRK10220          1 MSLPHCPKCNS-EYTYED--NGMYICPECAHEW   30 (111)
T ss_pred             CCCCcCCCCCC-cceEcC--CCeEECCcccCcC
Confidence            67778999998 344344  5679999999743


No 39 
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=94.40  E-value=0.041  Score=35.60  Aligned_cols=27  Identities=26%  Similarity=0.709  Sum_probs=20.0

Q ss_pred             CCCCCCCCCCceeEeCCCCc-------eEeCCCcc
Q 030241            4 AFCSDCKKHTEVVFDHSAGD-------TVCSECGL   31 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~-------~vC~~CG~   31 (181)
                      .-||.||+ ..+.++...+.       +.|.+||.
T Consensus         4 kPCPFCG~-~~~~~~~~~~~~~~~~~~V~C~~Cga   37 (61)
T PF14354_consen    4 KPCPFCGS-ADVLIRQDEGFDYGMYYYVECTDCGA   37 (61)
T ss_pred             cCCCCCCC-cceEeecccCCCCCCEEEEEcCCCCC
Confidence            46999997 56666665542       56999999


No 40 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=94.39  E-value=0.025  Score=41.44  Aligned_cols=31  Identities=23%  Similarity=0.664  Sum_probs=25.9

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      ++.||.||..   .+|-..--+||..||.++.-.
T Consensus         9 KR~Cp~CG~k---FYDLnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    9 KRTCPSCGAK---FYDLNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cccCCCCcch---hccCCCCCccCCCCCCccCcc
Confidence            4789999973   588888889999999998644


No 41 
>KOG0794 consensus CDK8 kinase-activating protein cyclin C [Transcription]
Probab=94.33  E-value=0.096  Score=43.36  Aligned_cols=53  Identities=8%  Similarity=0.048  Sum_probs=44.3

Q ss_pred             HHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh--h---CHHHHHHHHHHHHHHhCCCCc
Q 030241          107 LAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE--I---KTHYWLLACTLLVDKKTSHAL  159 (181)
Q Consensus       107 ~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~--l---~~~~v~AAclYiACR~~~~p~  159 (181)
                      -..+.|..++..|+|.+.|+-+  -+||...-+  +   ....+++-|||+||+.+..|+
T Consensus        43 ~~~n~I~~lg~~lklRQ~ViATAivY~rRfy~r~S~k~~~p~lla~TClyLAcKvEE~~i  102 (264)
T KOG0794|consen   43 FMANVIQKLGQHLKLRQRVIATAIVYFRRFYLRKSLKEIEPRLLAPTCLYLACKVEECPI  102 (264)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCHHHHHHHHHHHHhhhhhcch
Confidence            3567899999999999999888  566665433  3   899999999999999999983


No 42 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=94.29  E-value=0.044  Score=33.25  Aligned_cols=26  Identities=31%  Similarity=0.827  Sum_probs=20.2

Q ss_pred             CCCCCCCCCCCCceeEeCCCCceEeCCCc
Q 030241            2 TDAFCSDCKKHTEVVFDHSAGDTVCSECG   30 (181)
Q Consensus         2 ~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG   30 (181)
                      -...||.||.  ++.. ..+|.++|..|+
T Consensus        16 L~~~Cp~C~~--PL~~-~k~g~~~Cv~C~   41 (41)
T PF06677_consen   16 LDEHCPDCGT--PLMR-DKDGKIYCVSCG   41 (41)
T ss_pred             hcCccCCCCC--eeEE-ecCCCEECCCCC
Confidence            3467999985  4545 578999999996


No 43 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=94.23  E-value=0.037  Score=34.56  Aligned_cols=28  Identities=25%  Similarity=0.670  Sum_probs=19.3

Q ss_pred             CCCCCCCCCceeEeCC-C-CceEeCCCccccc
Q 030241            5 FCSDCKKHTEVVFDHS-A-GDTVCSECGLVLE   34 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~-~-G~~vC~~CG~Vl~   34 (181)
                      .||+||+  -+..... . ...+|..||.+..
T Consensus         2 FCp~Cg~--~l~~~~~~~~~~~vC~~Cg~~~~   31 (52)
T smart00661        2 FCPKCGN--MLIPKEGKEKRRFVCRKCGYEEP   31 (52)
T ss_pred             CCCCCCC--ccccccCCCCCEEECCcCCCeEE
Confidence            6999997  2333322 2 3799999998754


No 44 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=94.23  E-value=0.021  Score=33.59  Aligned_cols=29  Identities=28%  Similarity=0.653  Sum_probs=20.7

Q ss_pred             CCCCCCCCCCceeEeC-----CCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDH-----SAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~-----~~G~~vC~~CG~Vl~   34 (181)
                      ..||+|+..  ..++.     ..+.+.|..||.++.
T Consensus         3 ~~CP~C~~~--~~v~~~~~~~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTS--FRVVDSQLGANGGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCE--EEeCHHHcCCCCCEEECCCCCCEEE
Confidence            569999972  33332     345799999999874


No 45 
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=94.14  E-value=0.053  Score=36.16  Aligned_cols=17  Identities=29%  Similarity=0.788  Sum_probs=15.6

Q ss_pred             EeCCCCceEeCCCcccc
Q 030241           17 FDHSAGDTVCSECGLVL   33 (181)
Q Consensus        17 ~D~~~G~~vC~~CG~Vl   33 (181)
                      ++..+|.++|.+||.+.
T Consensus        47 ~~i~eg~L~Cp~c~r~Y   63 (68)
T PF03966_consen   47 VEIVEGELICPECGREY   63 (68)
T ss_dssp             EETTTTEEEETTTTEEE
T ss_pred             ccccCCEEEcCCCCCEE
Confidence            68899999999999986


No 46 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=94.13  E-value=0.043  Score=42.68  Aligned_cols=30  Identities=27%  Similarity=0.576  Sum_probs=20.6

Q ss_pred             CCCCCCCCCCceeEeCC---CCc-----eEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHS---AGD-----TVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~---~G~-----~vC~~CG~Vl   33 (181)
                      |+||+||++...+.|..   .|.     .-|.+||.-.
T Consensus         1 m~cp~c~~~~~~~~~s~~~~~~~~~~~~~~c~~c~~~f   38 (154)
T PRK00464          1 MRCPFCGHPDTRVIDSRPAEDGNAIRRRRECLACGKRF   38 (154)
T ss_pred             CcCCCCCCCCCEeEeccccCCCCceeeeeeccccCCcc
Confidence            57999998433566653   453     3499999764


No 47 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=94.05  E-value=0.065  Score=30.43  Aligned_cols=28  Identities=21%  Similarity=0.498  Sum_probs=17.0

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      ..+|+.||+  ..+.....-..+|.+||..
T Consensus         3 ~rfC~~CG~--~t~~~~~g~~r~C~~Cg~~   30 (32)
T PF09297_consen    3 HRFCGRCGA--PTKPAPGGWARRCPSCGHE   30 (32)
T ss_dssp             TSB-TTT----BEEE-SSSS-EEESSSS-E
T ss_pred             CcccCcCCc--cccCCCCcCEeECCCCcCE
Confidence            368999997  3455666778999999975


No 48 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=93.73  E-value=0.033  Score=35.79  Aligned_cols=30  Identities=33%  Similarity=0.720  Sum_probs=20.5

Q ss_pred             CCCCCCCCCCceeEeCCCCc-eEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGD-TVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~-~vC~~CG~Vl~   34 (181)
                      -.||.||.. --+.|...|+ +.|.+||.-++
T Consensus         3 ~~CP~CG~~-iev~~~~~GeiV~Cp~CGaele   33 (54)
T TIGR01206         3 FECPDCGAE-IELENPELGELVICDECGAELE   33 (54)
T ss_pred             cCCCCCCCE-EecCCCccCCEEeCCCCCCEEE
Confidence            479999973 2223434455 56999999885


No 49 
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=93.64  E-value=0.043  Score=34.53  Aligned_cols=27  Identities=30%  Similarity=0.768  Sum_probs=23.0

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      ..||.||. ..+..|+.+ -+.|..||+.
T Consensus        20 ~~CPrCG~-gvfmA~H~d-R~~CGkCgyT   46 (51)
T COG1998          20 RFCPRCGP-GVFMADHKD-RWACGKCGYT   46 (51)
T ss_pred             ccCCCCCC-cchhhhcCc-eeEeccccce
Confidence            56999995 678888876 8999999986


No 50 
>COG2835 Uncharacterized conserved protein [Function unknown]
Probab=93.59  E-value=0.055  Score=35.45  Aligned_cols=30  Identities=27%  Similarity=0.669  Sum_probs=26.2

Q ss_pred             CCCCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            2 TDAFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         2 ~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      +...||.|+.  .+.+|.+.++++|..||+..
T Consensus         7 eiLaCP~~kg--~L~~~~~~~~L~c~~~~~aY   36 (60)
T COG2835           7 EILACPVCKG--PLVYDEEKQELICPRCKLAY   36 (60)
T ss_pred             eeeeccCcCC--cceEeccCCEEEecccCcee
Confidence            3457999996  49999999999999999986


No 51 
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=93.45  E-value=0.081  Score=40.76  Aligned_cols=30  Identities=30%  Similarity=0.742  Sum_probs=23.7

Q ss_pred             CCCCCCCCCCceeEeC---CCCceE-----eCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDH---SAGDTV-----CSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~---~~G~~v-----C~~CG~Vl   33 (181)
                      |+||.||....-|.|.   +.|..|     |..||.=.
T Consensus         1 M~CP~C~~~dtkViDSR~~~dg~~IRRRReC~~C~~RF   38 (147)
T TIGR00244         1 MHCPFCQHHNTRVLDSRLVEDGQSIRRRRECLECHERF   38 (147)
T ss_pred             CCCCCCCCCCCEeeeccccCCCCeeeecccCCccCCcc
Confidence            6799999866678887   677777     99999754


No 52 
>KOG1598 consensus Transcription initiation factor TFIIIB, Brf1 subunit [Transcription]
Probab=92.83  E-value=0.099  Score=47.76  Aligned_cols=22  Identities=9%  Similarity=-0.037  Sum_probs=21.0

Q ss_pred             CHHHHHHHHHHHHHHhCCCCcc
Q 030241          139 KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       139 ~~~~v~AAclYiACR~~~~p~t  160 (181)
                      ++..++.||||+|||+||+++|
T Consensus       207 RPsglcGAaLliAar~h~~~rs  228 (521)
T KOG1598|consen  207 RPSGLCGAALLIAARMHGFRRT  228 (521)
T ss_pred             CccchhHHHHHHHHHHcCcccc
Confidence            8899999999999999999987


No 53 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=92.79  E-value=0.071  Score=40.07  Aligned_cols=31  Identities=13%  Similarity=0.288  Sum_probs=26.2

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      ++.||.||..   .+|-..--+||..||.++...
T Consensus         9 Kr~Cp~cg~k---FYDLnk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300         9 KRICPNTGSK---FYDLNRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             cccCCCcCcc---ccccCCCCccCCCcCCccCcc
Confidence            4789999973   588889999999999998654


No 54 
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=92.59  E-value=0.11  Score=31.25  Aligned_cols=29  Identities=28%  Similarity=0.634  Sum_probs=15.9

Q ss_pred             CCCCCCCCCCcee-EeC--CCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVV-FDH--SAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv-~D~--~~G~~vC~~CG~V   32 (181)
                      .-||.||+....- ++.  .+|..+|..|+-+
T Consensus         4 ~pCP~CGG~DrFri~~d~~~~G~~~C~~C~~~   35 (40)
T PF08273_consen    4 GPCPICGGKDRFRIFDDKDGRGTWICRQCGGD   35 (40)
T ss_dssp             E--TTTT-TTTEEEETT----S-EEETTTTBE
T ss_pred             CCCCCCcCccccccCcCcccCCCEECCCCCCc
Confidence            4599999854443 443  5699999999434


No 55 
>KOG0835 consensus Cyclin L [General function prediction only]
Probab=92.50  E-value=0.35  Score=42.01  Aligned_cols=53  Identities=11%  Similarity=0.061  Sum_probs=38.1

Q ss_pred             HHHHHHHHHHHhCCchHH-HHHHHHHHHHhh-----h---CHHHHHHHHHHHHHHhCCCCcc
Q 030241          108 AFKTIATMSDRIGQMRYI-RRWKIKSLVEAE-----I---KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       108 a~~~I~~ia~~L~Lp~~v-~e~~i~k~a~~~-----l---~~~~v~AAclYiACR~~~~p~t  160 (181)
                      -.+.|-.+-..|+||++. +.+..+.-+.+.     +   +.+.+++||+|+|.|..++||.
T Consensus       141 Phklii~YLqtL~~~~~~~l~Q~~wNfmNDslRT~v~vry~pe~iACaciyLaAR~~eIpLp  202 (367)
T KOG0835|consen  141 PHKLIIMYLQTLQLPPNLKLLQAAWNFMNDSLRTDVFVRYSPESIACACIYLAARNLEIPLP  202 (367)
T ss_pred             cHHHHHHHHHHhcCCCchhHHHHHHHhhhhccccceeeecCHHHHHHHHHHHHHhhhcCCCC
Confidence            345666777788888876 333333333333     2   8999999999999999999885


No 56 
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=92.35  E-value=0.31  Score=35.57  Aligned_cols=33  Identities=24%  Similarity=0.697  Sum_probs=23.5

Q ss_pred             CCCCCCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            1 MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         1 m~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      |....||.|.+  +.+++ +.+.++|.+|+.--.+.
T Consensus         1 ~~lp~cp~c~s--EytYe-d~~~~~cpec~~ew~~~   33 (112)
T COG2824           1 MSLPPCPKCNS--EYTYE-DGGQLICPECAHEWNEN   33 (112)
T ss_pred             CCCCCCCccCC--ceEEe-cCceEeCchhccccccc
Confidence            45678999997  34444 35599999999765433


No 57 
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=92.27  E-value=0.29  Score=35.74  Aligned_cols=28  Identities=18%  Similarity=0.496  Sum_probs=20.4

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      -.||.|++ .....|  ...+||.+||.--.
T Consensus         3 p~CP~C~s-eytY~d--g~~~iCpeC~~EW~   30 (109)
T TIGR00686         3 PPCPKCNS-EYTYHD--GTQLICPSCLYEWN   30 (109)
T ss_pred             CcCCcCCC-cceEec--CCeeECcccccccc
Confidence            36999998 444444  55799999997643


No 58 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=91.87  E-value=0.11  Score=37.19  Aligned_cols=28  Identities=32%  Similarity=0.739  Sum_probs=21.6

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLES   35 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e   35 (181)
                      ..||+||+  .+  .+..+.++|..||.+.+.
T Consensus         1 ~fC~~Cg~--~l--~~~~~~~~C~~C~~~~~~   28 (104)
T TIGR01384         1 KFCPKCGS--LM--TPKNGVYVCPSCGYEKEK   28 (104)
T ss_pred             CCCcccCc--cc--ccCCCeEECcCCCCcccc
Confidence            36999997  23  455789999999998654


No 59 
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=91.85  E-value=0.13  Score=32.63  Aligned_cols=31  Identities=23%  Similarity=0.283  Sum_probs=20.0

Q ss_pred             CCCCCCCCCCceeE---eC--CCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVF---DH--SAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~---D~--~~G~~vC~~CG~Vl~   34 (181)
                      .-||.||+....+.   |.  ..|...|..||....
T Consensus         2 kPCPfCGg~~~~~~~~~~~~~~~~~~~C~~Cga~~~   37 (53)
T TIGR03655         2 KPCPFCGGADVYLRRGFDPLDLSHYFECSTCGASGP   37 (53)
T ss_pred             CCCCCCCCcceeeEeccCCCCCEEEEECCCCCCCcc
Confidence            35999998433132   32  344557999999864


No 60 
>KOG1779 consensus 40s ribosomal protein S27 [Translation, ribosomal structure and biogenesis]
Probab=91.67  E-value=0.089  Score=36.25  Aligned_cols=29  Identities=34%  Similarity=0.751  Sum_probs=26.5

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      .+||.|-. ...++.+++..++|.+|+.|+
T Consensus        35 VkC~gc~~-iT~vfSHaqtvVvc~~c~~il   63 (84)
T KOG1779|consen   35 VKCPGCFK-ITTVFSHAQTVVVCEGCSTIL   63 (84)
T ss_pred             EEcCCceE-EEEEeecCceEEEcCCCceEE
Confidence            67999986 678999999999999999997


No 61 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=91.06  E-value=0.031  Score=32.92  Aligned_cols=30  Identities=27%  Similarity=0.688  Sum_probs=22.3

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      ..||.||..-++.+++..-+.+|..||.-|
T Consensus         2 r~C~~Cg~~Yh~~~~pP~~~~~Cd~cg~~L   31 (36)
T PF05191_consen    2 RICPKCGRIYHIEFNPPKVEGVCDNCGGEL   31 (36)
T ss_dssp             EEETTTTEEEETTTB--SSTTBCTTTTEBE
T ss_pred             cCcCCCCCccccccCCCCCCCccCCCCCee
Confidence            369999985577788888889999999754


No 62 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=90.69  E-value=0.16  Score=29.94  Aligned_cols=30  Identities=33%  Similarity=0.545  Sum_probs=19.5

Q ss_pred             CCCCCCCCCCceeEeCC-CCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHS-AGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~-~G~~vC~~CG~Vl   33 (181)
                      -+|++||..-++..... .....|.+||.-+
T Consensus         6 y~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~~   36 (41)
T smart00834        6 YRCEDCGHTFEVLQKISDDPLATCPECGGDV   36 (41)
T ss_pred             EEcCCCCCEEEEEEecCCCCCCCCCCCCCcc
Confidence            46999997323333332 5567899999843


No 63 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=90.68  E-value=0.099  Score=30.79  Aligned_cols=30  Identities=27%  Similarity=0.635  Sum_probs=20.6

Q ss_pred             CCCCCCCCCCceeEe---CCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFD---HSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D---~~~G~~vC~~CG~Vl   33 (181)
                      ..||+|+..-.+-.|   ...+.+-|..||.+.
T Consensus         3 i~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDKLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             EECCCCCceEEcCHHHcccCCcEEECCCCCcEe
Confidence            469999973222111   247789999999885


No 64 
>KOG2496 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair]
Probab=90.58  E-value=0.63  Score=39.97  Aligned_cols=41  Identities=7%  Similarity=0.011  Sum_probs=35.0

Q ss_pred             CCchHHHHH--HHHHHHH-hh-h---CHHHHHHHHHHHHHHhCCCCcc
Q 030241          120 GQMRYIRRW--KIKSLVE-AE-I---KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       120 ~Lp~~v~e~--~i~k~a~-~~-l---~~~~v~AAclYiACR~~~~p~t  160 (181)
                      +||.+|+-+  .+||.+. +. .   ....+.++|+|+||+.+..-++
T Consensus        73 ~lp~~Vv~TA~~fFkRffL~nsvme~~pk~I~~tc~flA~Kieef~IS  120 (325)
T KOG2496|consen   73 NLPTSVVSTAIEFFKRFFLENSVMEYSPKIIMATCFFLACKIEEFYIS  120 (325)
T ss_pred             CCchHHHHHHHHHHHHHHHhcchhhcChHHHHHHHHHHHhhhHhheec
Confidence            789999999  8999873 43 3   8999999999999999877766


No 65 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=90.48  E-value=0.35  Score=29.64  Aligned_cols=28  Identities=21%  Similarity=0.453  Sum_probs=20.6

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCcc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGL   31 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~   31 (181)
                      ...||.||+ .....-...+..-|.+|+.
T Consensus        18 g~~CP~Cg~-~~~~~~~~~~~~~C~~C~~   45 (46)
T PF12760_consen   18 GFVCPHCGS-TKHYRLKTRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCC-eeeEEeCCCCeEECCCCCC
Confidence            356999998 4544444569999999974


No 66 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=90.31  E-value=0.2  Score=33.13  Aligned_cols=29  Identities=21%  Similarity=0.576  Sum_probs=21.1

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      +.||.||.. . ..+.......|..||...+
T Consensus        29 q~C~~CG~~-~-~~~~~~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   29 QTCPRCGHR-N-KKRRSGRVFTCPNCGFEMD   57 (69)
T ss_pred             cCccCcccc-c-ccccccceEEcCCCCCEEC
Confidence            579999973 2 2245677889999999864


No 67 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=90.19  E-value=0.18  Score=35.77  Aligned_cols=29  Identities=31%  Similarity=0.524  Sum_probs=24.7

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ..||.||. +. +.-...|-.-|..||.++.
T Consensus        36 y~Cp~Cgk-~~-vkR~a~GIW~C~~C~~~~A   64 (90)
T PF01780_consen   36 YTCPFCGK-TS-VKRVATGIWKCKKCGKKFA   64 (90)
T ss_dssp             BEESSSSS-SE-EEEEETTEEEETTTTEEEE
T ss_pred             CcCCCCCC-ce-eEEeeeEEeecCCCCCEEe
Confidence            56999997 44 6778999999999999874


No 68 
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=90.10  E-value=0.23  Score=36.64  Aligned_cols=34  Identities=29%  Similarity=0.579  Sum_probs=24.0

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      +..||.||+---.-.|...+.++|..||...+-+
T Consensus         2 m~FCp~Cgsll~p~~~~~~~~l~C~kCgye~~~~   35 (113)
T COG1594           2 MRFCPKCGSLLYPKKDDEGGKLVCRKCGYEEEAS   35 (113)
T ss_pred             ccccCCccCeeEEeEcCCCcEEECCCCCcchhcc
Confidence            5789999972111123367799999999987654


No 69 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=90.02  E-value=0.2  Score=32.73  Aligned_cols=26  Identities=31%  Similarity=0.754  Sum_probs=12.3

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      .|..||.  .|..+..--.-.|.+||.+
T Consensus        11 ~CtSCg~--~i~p~e~~v~F~CPnCGe~   36 (61)
T COG2888          11 VCTSCGR--EIAPGETAVKFPCPNCGEV   36 (61)
T ss_pred             eeccCCC--EeccCCceeEeeCCCCCce
Confidence            5666664  2223333333456666643


No 70 
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=89.76  E-value=0.38  Score=41.15  Aligned_cols=43  Identities=23%  Similarity=0.454  Sum_probs=28.2

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc-------cCCccccccccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE-------SHSIDETSEWRTFA   48 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~-------e~~id~~~Ewr~F~   48 (181)
                      .+||+|+. .-...|-.....||..||.-..       +.++|.++ |+.+.
T Consensus        28 ~~c~~c~~-~~~~~~l~~~~~vc~~c~~h~rl~areRi~~L~D~gs-F~E~~   77 (292)
T PRK05654         28 TKCPSCGQ-VLYRKELEANLNVCPKCGHHMRISARERLDLLLDEGS-FVELD   77 (292)
T ss_pred             eECCCccc-hhhHHHHHhcCCCCCCCCCCeeCCHHHHHHHHccCCc-cEEec
Confidence            57999997 3333444666789999998765       23466653 44443


No 71 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=89.64  E-value=0.27  Score=30.16  Aligned_cols=27  Identities=30%  Similarity=0.720  Sum_probs=19.7

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      .+|.+||.  ++..+ ..+.+-|.+||.=+
T Consensus         3 Y~C~~Cg~--~~~~~-~~~~irC~~CG~rI   29 (44)
T smart00659        3 YICGECGR--ENEIK-SKDVVRCRECGYRI   29 (44)
T ss_pred             EECCCCCC--EeecC-CCCceECCCCCceE
Confidence            47999997  33333 56889999999643


No 72 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=89.47  E-value=0.32  Score=29.11  Aligned_cols=27  Identities=30%  Similarity=0.568  Sum_probs=19.1

Q ss_pred             CCCCCCCCCceeEe---------CCCCceEeCCCccc
Q 030241            5 FCSDCKKHTEVVFD---------HSAGDTVCSECGLV   32 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D---------~~~G~~vC~~CG~V   32 (181)
                      .||.||. .+.++-         +.+-..+|.+||..
T Consensus         2 ~Cp~C~~-~~a~~~q~Q~RsaDE~mT~fy~C~~C~~~   37 (40)
T smart00440        2 PCPKCGN-REATFFQLQTRSADEPMTVFYVCTKCGHR   37 (40)
T ss_pred             cCCCCCC-CeEEEEEEcccCCCCCCeEEEEeCCCCCE
Confidence            6999997 555542         23447899999964


No 73 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=89.36  E-value=0.31  Score=36.01  Aligned_cols=26  Identities=31%  Similarity=0.617  Sum_probs=20.3

Q ss_pred             CCCCCCCCceeEeCCCCceEeCCCccccccCC
Q 030241            6 CSDCKKHTEVVFDHSAGDTVCSECGLVLESHS   37 (181)
Q Consensus         6 Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~   37 (181)
                      ||.||+ .-.|+     .+-|.+||+.++-+.
T Consensus         1 CPvCg~-~l~vt-----~l~C~~C~t~i~G~F   26 (113)
T PF09862_consen    1 CPVCGG-ELVVT-----RLKCPSCGTEIEGEF   26 (113)
T ss_pred             CCCCCC-ceEEE-----EEEcCCCCCEEEeee
Confidence            999997 44444     599999999997543


No 74 
>KOG0835 consensus Cyclin L [General function prediction only]
Probab=89.21  E-value=1.5  Score=38.23  Aligned_cols=59  Identities=14%  Similarity=0.064  Sum_probs=48.2

Q ss_pred             hHHHHHHHHHHHHHHHHhCCchHHHHH--HHHHHH-Hhh-h---CHHHHHHHHHHHHHHhCCCCcc
Q 030241          102 DRGLILAFKTIATMSDRIGQMRYIRRW--KIKSLV-EAE-I---KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       102 er~l~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a-~~~-l---~~~~v~AAclYiACR~~~~p~t  160 (181)
                      +--..-+-..|++-+=.|+||+...-+  -+|... ..+ |   ..++++.|||.+|.+.+..|.+
T Consensus        20 ~el~~LG~e~Iqea~ILL~L~q~a~atgqVLFqRf~~~ks~v~~~~e~vv~ACv~LASKiEE~Prr   85 (367)
T KOG0835|consen   20 EELRILGCELIQEAGILLNLPQVAMATGQVLFQRFCYSKSFVRHDFEIVVMACVLLASKIEEEPRR   85 (367)
T ss_pred             HHHHHHhHHHHHhhhHhhcCcHHHHHHHHHHHHHHHhccccccccHHHHHHHHHHHHhhhcccccc
Confidence            334456889999999999999998777  555554 555 5   8999999999999999999865


No 75 
>PRK05978 hypothetical protein; Provisional
Probab=89.18  E-value=0.32  Score=37.63  Aligned_cols=35  Identities=20%  Similarity=0.442  Sum_probs=23.5

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCCcc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSID   39 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id   39 (181)
                      .+||.||. ..+..-+-.=..-|..||.-++-..-|
T Consensus        34 grCP~CG~-G~LF~g~Lkv~~~C~~CG~~~~~~~a~   68 (148)
T PRK05978         34 GRCPACGE-GKLFRAFLKPVDHCAACGEDFTHHRAD   68 (148)
T ss_pred             CcCCCCCC-CcccccccccCCCccccCCccccCCcc
Confidence            57999997 665333333446799999988644333


No 76 
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=89.16  E-value=0.27  Score=38.04  Aligned_cols=30  Identities=30%  Similarity=0.644  Sum_probs=21.6

Q ss_pred             CCCCCCCCCCceeEeC---CCCce-----EeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDH---SAGDT-----VCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~---~~G~~-----vC~~CG~Vl   33 (181)
                      |+||.|+....=|.|+   +.|..     .|.+||.=.
T Consensus         1 M~CPfC~~~~tkViDSR~~edg~aIRRRReC~~C~~RF   38 (156)
T COG1327           1 MKCPFCGHEDTKVIDSRPAEEGNAIRRRRECLECGERF   38 (156)
T ss_pred             CCCCCCCCCCCeeeecccccccchhhhhhccccccccc
Confidence            6799999865667776   45544     488888654


No 77 
>PRK12495 hypothetical protein; Provisional
Probab=89.13  E-value=0.26  Score=40.37  Aligned_cols=32  Identities=28%  Similarity=0.778  Sum_probs=25.3

Q ss_pred             CCCCCCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            1 MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         1 m~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      |....|+.||.+  | + ...|.++|..|+.++.+.
T Consensus        40 msa~hC~~CG~P--I-p-a~pG~~~Cp~CQ~~~~~~   71 (226)
T PRK12495         40 MTNAHCDECGDP--I-F-RHDGQEFCPTCQQPVTED   71 (226)
T ss_pred             cchhhcccccCc--c-c-CCCCeeECCCCCCccccc
Confidence            556789999973  3 3 458999999999998753


No 78 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=89.09  E-value=0.3  Score=34.65  Aligned_cols=30  Identities=27%  Similarity=0.516  Sum_probs=24.7

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ...||.||. +. +.-...|-..|..||.++.
T Consensus        36 ~y~CpfCgk-~~-vkR~a~GIW~C~~C~~~~A   65 (90)
T PTZ00255         36 KYFCPFCGK-HA-VKRQAVGIWRCKGCKKTVA   65 (90)
T ss_pred             CccCCCCCC-Cc-eeeeeeEEEEcCCCCCEEe
Confidence            467999997 44 5667889999999999974


No 79 
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=88.97  E-value=0.26  Score=35.57  Aligned_cols=29  Identities=34%  Similarity=0.865  Sum_probs=22.3

Q ss_pred             CCCCCCCCCcee---EeC--CCCceEeCCCccccc
Q 030241            5 FCSDCKKHTEVV---FDH--SAGDTVCSECGLVLE   34 (181)
Q Consensus         5 ~Cp~Cg~~~~iv---~D~--~~G~~vC~~CG~Vl~   34 (181)
                      .||.||. -.++   +|-  .-|.++|..||+=.+
T Consensus        24 tCp~Cgh-e~vs~ctvkk~~~~g~~~Cg~CGls~e   57 (104)
T COG4888          24 TCPRCGH-EKVSSCTVKKTVNIGTAVCGNCGLSFE   57 (104)
T ss_pred             ecCccCC-eeeeEEEEEecCceeEEEcccCcceEE
Confidence            5999996 4555   443  678999999998765


No 80 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=88.15  E-value=0.29  Score=28.00  Aligned_cols=25  Identities=28%  Similarity=0.660  Sum_probs=16.8

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      .|.+||..   +.+.....+-|.+||.=
T Consensus         2 ~C~~Cg~~---~~~~~~~~irC~~CG~R   26 (32)
T PF03604_consen    2 ICGECGAE---VELKPGDPIRCPECGHR   26 (32)
T ss_dssp             BESSSSSS---E-BSTSSTSSBSSSS-S
T ss_pred             CCCcCCCe---eEcCCCCcEECCcCCCe
Confidence            58899972   23455667889999963


No 81 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=88.14  E-value=0.28  Score=35.38  Aligned_cols=42  Identities=24%  Similarity=0.480  Sum_probs=28.2

Q ss_pred             CCCCCCCCCCc--eeEeCCCCceEeCCCccccccC------Cccccccccc
Q 030241            4 AFCSDCKKHTE--VVFDHSAGDTVCSECGLVLESH------SIDETSEWRT   46 (181)
Q Consensus         4 ~~Cp~Cg~~~~--iv~D~~~G~~vC~~CG~Vl~e~------~id~~~Ewr~   46 (181)
                      ..||+||. ..  +-.|...+..+|..||+--+-.      .||--.+|..
T Consensus        22 f~CP~Cge-~~v~v~~~k~~~h~~C~~CG~y~~~~V~~l~epIDVY~~wiD   71 (99)
T PRK14892         22 FECPRCGK-VSISVKIKKNIAIITCGNCGLYTEFEVPSVYDEVDVYNKFID   71 (99)
T ss_pred             eECCCCCC-eEeeeecCCCcceEECCCCCCccCEECCccccchhhHHHHHH
Confidence            35999995 32  3345678899999999986532      2444456643


No 82 
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=87.97  E-value=0.54  Score=26.00  Aligned_cols=22  Identities=23%  Similarity=0.540  Sum_probs=12.2

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCC
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSE   28 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~   28 (181)
                      .||.||+  .++.+..+-.+.|.+
T Consensus         1 ~CP~C~s--~l~~~~~ev~~~C~N   22 (28)
T PF03119_consen    1 TCPVCGS--KLVREEGEVDIRCPN   22 (28)
T ss_dssp             B-TTT----BEEE-CCTTCEEE--
T ss_pred             CcCCCCC--EeEcCCCCEeEECCC
Confidence            4999997  577776777788875


No 83 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=87.57  E-value=0.38  Score=34.15  Aligned_cols=30  Identities=30%  Similarity=0.552  Sum_probs=24.9

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ...||.||. +. +.-...|-..|..||.++.
T Consensus        35 ~y~CpfCgk-~~-vkR~a~GIW~C~~C~~~~A   64 (91)
T TIGR00280        35 KYVCPFCGK-KT-VKRGSTGIWTCRKCGAKFA   64 (91)
T ss_pred             CccCCCCCC-Cc-eEEEeeEEEEcCCCCCEEe
Confidence            467999997 44 5677899999999999974


No 84 
>PF12773 DZR:  Double zinc ribbon
Probab=87.02  E-value=0.39  Score=29.65  Aligned_cols=12  Identities=33%  Similarity=0.852  Sum_probs=5.6

Q ss_pred             ceEeCCCccccc
Q 030241           23 DTVCSECGLVLE   34 (181)
Q Consensus        23 ~~vC~~CG~Vl~   34 (181)
                      ..+|..||..|.
T Consensus        12 ~~fC~~CG~~l~   23 (50)
T PF12773_consen   12 AKFCPHCGTPLP   23 (50)
T ss_pred             ccCChhhcCChh
Confidence            444444444443


No 85 
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=86.93  E-value=0.31  Score=36.38  Aligned_cols=39  Identities=18%  Similarity=0.368  Sum_probs=25.7

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCCcccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSE   43 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~~~E   43 (181)
                      -.||+||. ..+.--.-.=.-.|..||+=+...--|++|-
T Consensus        22 grCP~CGe-GrLF~gFLK~~p~C~aCG~dyg~~~a~DgPa   60 (126)
T COG5349          22 GRCPRCGE-GRLFRGFLKVVPACEACGLDYGFADADDGPA   60 (126)
T ss_pred             CCCCCCCC-chhhhhhcccCchhhhccccccCCcccCCCc
Confidence            46999997 5543223444568999999876555555543


No 86 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=86.83  E-value=0.24  Score=34.40  Aligned_cols=32  Identities=25%  Similarity=0.571  Sum_probs=17.7

Q ss_pred             CCCCCCCCCcee--EeC--CCCceEeCCCccccccC
Q 030241            5 FCSDCKKHTEVV--FDH--SAGDTVCSECGLVLESH   36 (181)
Q Consensus         5 ~Cp~Cg~~~~iv--~D~--~~G~~vC~~CG~Vl~e~   36 (181)
                      .||.|+....+.  .|.  ..|.+.|..||...+-.
T Consensus        24 ~CPfC~~~~sV~v~idkk~~~~~~~C~~Cg~~~~~~   59 (81)
T PF05129_consen   24 DCPFCNHEKSVSVKIDKKEGIGILSCRVCGESFQTK   59 (81)
T ss_dssp             --TTT--SS-EEEEEETTTTEEEEEESSS--EEEEE
T ss_pred             cCCcCCCCCeEEEEEEccCCEEEEEecCCCCeEEEc
Confidence            599999434433  443  57899999999987643


No 87 
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=86.52  E-value=0.46  Score=33.67  Aligned_cols=30  Identities=23%  Similarity=0.546  Sum_probs=24.7

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ...||.||. +. +.-...|-.-|..||.++.
T Consensus        36 ~y~CpfCgk-~~-vkR~a~GIW~C~~C~~~~A   65 (90)
T PRK03976         36 KHVCPVCGR-PK-VKRVGTGIWECRKCGAKFA   65 (90)
T ss_pred             CccCCCCCC-Cc-eEEEEEEEEEcCCCCCEEe
Confidence            467999997 44 5667899999999999974


No 88 
>PRK09710 lar restriction alleviation and modification protein; Reviewed
Probab=86.36  E-value=0.73  Score=30.59  Aligned_cols=28  Identities=21%  Similarity=0.398  Sum_probs=19.0

Q ss_pred             CCCCCCCCCCceeEeCCCCc--eEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGD--TVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~--~vC~~CG~V   32 (181)
                      .-||.||.. .+..-...|-  .+|..||..
T Consensus         7 KPCPFCG~~-~~~v~~~~g~~~v~C~~CgA~   36 (64)
T PRK09710          7 KPCPFCGCP-SVTVKAISGYYRAKCNGCESR   36 (64)
T ss_pred             cCCCCCCCc-eeEEEecCceEEEEcCCCCcC
Confidence            459999984 4444333443  589999985


No 89 
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=86.31  E-value=0.52  Score=31.31  Aligned_cols=14  Identities=21%  Similarity=0.422  Sum_probs=10.0

Q ss_pred             CCCCCCCCCceeEeC
Q 030241            5 FCSDCKKHTEVVFDH   19 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~   19 (181)
                      +||.||. ++.+++.
T Consensus         6 kCpKCgn-~~~~eke   19 (68)
T COG3478           6 KCPKCGN-TNYEEKE   19 (68)
T ss_pred             cCCCcCC-cchhhce
Confidence            4999997 5655554


No 90 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=85.62  E-value=0.71  Score=30.15  Aligned_cols=29  Identities=28%  Similarity=0.597  Sum_probs=15.3

Q ss_pred             CCCCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            2 TDAFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         2 ~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      ...+|..||.  .|..-...-.-.|.+||.+
T Consensus         6 ~~~~CtSCg~--~i~~~~~~~~F~CPnCG~~   34 (59)
T PRK14890          6 EPPKCTSCGI--EIAPREKAVKFLCPNCGEV   34 (59)
T ss_pred             cCccccCCCC--cccCCCccCEeeCCCCCCe
Confidence            3456777775  2321111334567777766


No 91 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=85.34  E-value=0.61  Score=27.72  Aligned_cols=27  Identities=33%  Similarity=0.616  Sum_probs=15.2

Q ss_pred             CCCCCCCCCceeEeC---------CCCceEeCCCccc
Q 030241            5 FCSDCKKHTEVVFDH---------SAGDTVCSECGLV   32 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~---------~~G~~vC~~CG~V   32 (181)
                      .||.||. .+.++-.         .+-..+|.+||..
T Consensus         2 ~Cp~Cg~-~~a~~~~~Q~rsaDE~~T~fy~C~~C~~~   37 (39)
T PF01096_consen    2 KCPKCGH-NEAVFFQIQTRSADEPMTLFYVCCNCGHR   37 (39)
T ss_dssp             --SSS-S-SEEEEEEESSSSSSSSSEEEEEESSSTEE
T ss_pred             CCcCCCC-CeEEEEEeeccCCCCCCeEEEEeCCCCCe
Confidence            6999997 4443331         2335789999964


No 92 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=85.11  E-value=0.83  Score=30.35  Aligned_cols=27  Identities=26%  Similarity=0.714  Sum_probs=16.9

Q ss_pred             CCCCCCCCCceeEeC--CCC---------------ceEeCCCccc
Q 030241            5 FCSDCKKHTEVVFDH--SAG---------------DTVCSECGLV   32 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~--~~G---------------~~vC~~CG~V   32 (181)
                      .||.||+ .+...+.  .+|               .++|++||+.
T Consensus         2 ~C~KCg~-~~~e~~~v~~tgg~~skiFdvq~~~f~~v~C~~CGYT   45 (64)
T PF09855_consen    2 KCPKCGN-EEYESGEVRATGGGLSKIFDVQNKKFTTVSCTNCGYT   45 (64)
T ss_pred             CCCCCCC-cceecceEEccCCeeEEEEEecCcEEEEEECCCCCCE
Confidence            6999997 4443332  111               2579999886


No 93 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=84.59  E-value=1  Score=30.65  Aligned_cols=31  Identities=13%  Similarity=0.308  Sum_probs=21.9

Q ss_pred             CCCCCCCCCCCceeEeC-------CCCceEeC--CCccccc
Q 030241            3 DAFCSDCKKHTEVVFDH-------SAGDTVCS--ECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~-------~~G~~vC~--~CG~Vl~   34 (181)
                      ++.||.||. ...+.+.       .+-...|+  +||....
T Consensus         1 mm~CP~Cg~-~a~irtSr~~s~~~~~~Y~qC~N~eCg~tF~   40 (72)
T PRK09678          1 MFHCPLCQH-AAHARTSRYITDTTKERYHQCQNVNCSATFI   40 (72)
T ss_pred             CccCCCCCC-ccEEEEChhcChhhheeeeecCCCCCCCEEE
Confidence            478999998 5666665       22345688  8998764


No 94 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=84.04  E-value=0.27  Score=39.08  Aligned_cols=31  Identities=26%  Similarity=0.558  Sum_probs=21.4

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLES   35 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e   35 (181)
                      -.||.|+.. -...|.-+..-.|..||.+|.+
T Consensus       118 Y~Cp~C~~r-ytf~eA~~~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        118 FFCPNCHIR-FTFDEAMEYGFRCPQCGEMLEE  148 (178)
T ss_pred             EECCCCCcE-EeHHHHhhcCCcCCCCCCCCee
Confidence            359999862 2223345667889999999864


No 95 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=83.98  E-value=0.76  Score=29.25  Aligned_cols=28  Identities=36%  Similarity=0.688  Sum_probs=20.2

Q ss_pred             CCCCCCCCCceeEeCCCCce----EeCCCccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDT----VCSECGLV   32 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~----vC~~CG~V   32 (181)
                      .||+||....+..|...|+.    =|.-|-.=
T Consensus         2 ~CPyCge~~~~~iD~s~~~Q~yiEDC~vCC~P   33 (52)
T PF14255_consen    2 QCPYCGEPIEILIDPSAGDQEYIEDCQVCCRP   33 (52)
T ss_pred             CCCCCCCeeEEEEecCCCCeeEEeehhhcCCc
Confidence            59999987778899887752    25555543


No 96 
>PRK02935 hypothetical protein; Provisional
Probab=83.64  E-value=0.85  Score=33.23  Aligned_cols=38  Identities=26%  Similarity=0.575  Sum_probs=24.4

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCCccccccccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFA   48 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~~~Ewr~F~   48 (181)
                      ..||+|++.+.+.=    -...|..|+.-|.   +|.+.|-..|+
T Consensus        71 V~CP~C~K~TKmLG----rvD~CM~C~~PLT---Ld~~legkefd  108 (110)
T PRK02935         71 VICPSCEKPTKMLG----RVDACMHCNQPLT---LDRSLEGKEFD  108 (110)
T ss_pred             eECCCCCchhhhcc----ceeecCcCCCcCC---cCccccccCcC
Confidence            56999998654432    2348999999885   45444433343


No 97 
>COG4640 Predicted membrane protein [Function unknown]
Probab=83.31  E-value=0.66  Score=41.25  Aligned_cols=28  Identities=29%  Similarity=0.800  Sum_probs=20.6

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      |..||.||+. .     .+++.-|+.||.=+..+
T Consensus         1 M~fC~kcG~q-k-----~Ed~~qC~qCG~~~t~~   28 (465)
T COG4640           1 MKFCPKCGSQ-K-----AEDDVQCTQCGHKFTSR   28 (465)
T ss_pred             CCcccccccc-c-----ccccccccccCCcCCch
Confidence            4589999973 2     35667799999877544


No 98 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=82.11  E-value=0.54  Score=27.50  Aligned_cols=29  Identities=28%  Similarity=0.650  Sum_probs=19.5

Q ss_pred             CCCCCCCCCCceeEe----CCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFD----HSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D----~~~G~~vC~~CG~Vl   33 (181)
                      ..||+|+.. --+-|    .....+-|+.||.+.
T Consensus         3 i~Cp~C~~~-y~i~d~~ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAK-YEIDDEKIPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCE-EeCCHHHCCCCCcEEECCCCCCEe
Confidence            469999973 22222    245568899999874


No 99 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=82.04  E-value=0.51  Score=29.71  Aligned_cols=28  Identities=29%  Similarity=0.669  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      .+|-.||.  .+..|.....+.|..||.=+
T Consensus         7 Y~C~~Cg~--~~~~~~~~~~irCp~Cg~rI   34 (49)
T COG1996           7 YKCARCGR--EVELDQETRGIRCPYCGSRI   34 (49)
T ss_pred             EEhhhcCC--eeehhhccCceeCCCCCcEE
Confidence            46999997  35557788999999999643


No 100
>TIGR02443 conserved hypothetical metal-binding protein. Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various Proteobacteria.
Probab=82.03  E-value=1.5  Score=28.63  Aligned_cols=30  Identities=23%  Similarity=0.562  Sum_probs=19.8

Q ss_pred             CCCCCCCCCCCceeEeCCCC--ceEeCCCccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAG--DTVCSECGLV   32 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G--~~vC~~CG~V   32 (181)
                      .-.||.|+.-..+..=.+.|  ..-|.+||+-
T Consensus         9 GA~CP~C~~~Dtl~~~~e~~~e~vECv~Cg~~   40 (59)
T TIGR02443         9 GAVCPACSAQDTLAMWKENNIELVECVECGYQ   40 (59)
T ss_pred             cccCCCCcCccEEEEEEeCCceEEEeccCCCc
Confidence            35799999743343322333  3779999987


No 101
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=81.97  E-value=0.85  Score=29.56  Aligned_cols=27  Identities=22%  Similarity=0.596  Sum_probs=18.5

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHS   37 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~   37 (181)
                      ..||+||+. .      .--.+|.+||+--+..+
T Consensus        28 ~~C~~CG~~-~------~~H~vC~~CG~Y~gr~v   54 (57)
T PRK12286         28 VECPNCGEP-K------LPHRVCPSCGYYKGREV   54 (57)
T ss_pred             eECCCCCCc-c------CCeEECCCCCcCCCEEe
Confidence            469999972 2      23589999997654443


No 102
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=81.79  E-value=0.9  Score=28.26  Aligned_cols=28  Identities=29%  Similarity=0.567  Sum_probs=16.8

Q ss_pred             CCCCCCCCCCceeEe-CCCCceEeCCCcc
Q 030241            4 AFCSDCKKHTEVVFD-HSAGDTVCSECGL   31 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D-~~~G~~vC~~CG~   31 (181)
                      .+|++||..-++... .+...+.|..||.
T Consensus         6 y~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMSDDPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEecCCCCCCCCCCCCC
Confidence            468888852232222 1245677999987


No 103
>KOG4164 consensus Cyclin ik3-1/CABLES [Cell cycle control, cell division, chromosome partitioning]
Probab=81.37  E-value=2.7  Score=37.54  Aligned_cols=49  Identities=14%  Similarity=0.099  Sum_probs=33.0

Q ss_pred             HHHHHHHHHhCCchHHHHH--HHHHH-HHhh-h---CHHHHHHHHHHHHHHhCCCC
Q 030241          110 KTIATMSDRIGQMRYIRRW--KIKSL-VEAE-I---KTHYWLLACTLLVDKKTSHA  158 (181)
Q Consensus       110 ~~I~~ia~~L~Lp~~v~e~--~i~k~-a~~~-l---~~~~v~AAclYiACR~~~~p  158 (181)
                      ++++++...-+|-...+-+  -+|.| +.+. +   +++..+.|||.+|.++++..
T Consensus       387 REMr~l~~d~~id~~TVa~AyVYFEKliLkglisK~NRKlcAGAclLlaaKmnD~K  442 (497)
T KOG4164|consen  387 REMRELGEDCGIDVVTVAMAYVYFEKLILKGLISKQNRKLCAGACLLLAAKMNDLK  442 (497)
T ss_pred             HHHHHhhhccCccceeehhHHHHHHHHHHhhhhhhhhhhHHHHHHHHHHHHhhhhh
Confidence            3555555555554443444  56666 4666 4   88999999999999998654


No 104
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=81.31  E-value=1.3  Score=25.28  Aligned_cols=23  Identities=30%  Similarity=0.807  Sum_probs=14.6

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCcc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGL   31 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~   31 (181)
                      .|+.||-    +.|.......|..||.
T Consensus         3 ~C~~CGy----~y~~~~~~~~CP~Cg~   25 (33)
T cd00350           3 VCPVCGY----IYDGEEAPWVCPVCGA   25 (33)
T ss_pred             ECCCCCC----EECCCcCCCcCcCCCC
Confidence            4777773    3455556667777775


No 105
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=81.25  E-value=0.9  Score=34.43  Aligned_cols=7  Identities=29%  Similarity=0.871  Sum_probs=6.1

Q ss_pred             CCCCCCC
Q 030241            5 FCSDCKK   11 (181)
Q Consensus         5 ~Cp~Cg~   11 (181)
                      -||+||.
T Consensus        79 gCP~CGn   85 (131)
T PF15616_consen   79 GCPHCGN   85 (131)
T ss_pred             CCCCCcC
Confidence            5999997


No 106
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=80.99  E-value=1.3  Score=28.46  Aligned_cols=27  Identities=30%  Similarity=0.594  Sum_probs=19.6

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      ..+|+.||..  + . +..--+||.+||.+.
T Consensus         5 ~~~C~~Cg~~--~-~-~~dDiVvCp~Cgapy   31 (54)
T PF14446_consen    5 GCKCPVCGKK--F-K-DGDDIVVCPECGAPY   31 (54)
T ss_pred             CccChhhCCc--c-c-CCCCEEECCCCCCcc
Confidence            3679999962  2 2 234568999999986


No 107
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=80.93  E-value=0.77  Score=29.71  Aligned_cols=24  Identities=21%  Similarity=0.522  Sum_probs=18.4

Q ss_pred             CCCCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            2 TDAFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         2 ~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      -+.+|+.||. ..+       ..+|..||...
T Consensus         4 ~mr~C~~Cgv-YTL-------k~~CP~CG~~t   27 (56)
T PRK13130          4 KIRKCPKCGV-YTL-------KEICPVCGGKT   27 (56)
T ss_pred             cceECCCCCC-EEc-------cccCcCCCCCC
Confidence            3578999996 333       57999999775


No 108
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=80.86  E-value=0.99  Score=24.98  Aligned_cols=28  Identities=18%  Similarity=0.372  Sum_probs=16.0

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGL   31 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~   31 (181)
                      .+||.|+....-+....++..+|..|=-
T Consensus         2 ~~C~rC~~~~~~~~~~~r~~~~C~rCq~   29 (30)
T PF06827_consen    2 EKCPRCWNYIEDIGINGRSTYLCPRCQK   29 (30)
T ss_dssp             SB-TTT--BBEEEEETTEEEEE-TTTCC
T ss_pred             CcCccCCCcceEeEecCCCCeECcCCcC
Confidence            5799999743334445777889988843


No 109
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=80.79  E-value=1.4  Score=31.93  Aligned_cols=31  Identities=23%  Similarity=0.513  Sum_probs=19.4

Q ss_pred             CCCCCCCCCCCceeEe------C--CC-Cc-eEeCCCccccc
Q 030241            3 DAFCSDCKKHTEVVFD------H--SA-GD-TVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D------~--~~-G~-~vC~~CG~Vl~   34 (181)
                      +.+||.||.+ ....+      .  .. .. .+|+.|+.=++
T Consensus         2 p~~CpYCg~~-~~l~~~~~iYg~~~~~~~~~y~C~~C~AyVG   42 (102)
T PF11672_consen    2 PIICPYCGGP-AELVDGSEIYGHRYDDGPYLYVCTPCDAYVG   42 (102)
T ss_pred             CcccCCCCCe-eEEcccchhcCccCCCCceeEECCCCCceee
Confidence            5789999983 44444      1  11 22 68888877664


No 110
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=80.55  E-value=0.51  Score=34.74  Aligned_cols=39  Identities=26%  Similarity=0.516  Sum_probs=24.8

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCCcccccccccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFAN   49 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~~~Ewr~F~~   49 (181)
                      ..||+|+..+.+.=.    ...|..|+.-+.   +|.+.|-..|++
T Consensus        70 V~CP~C~K~TKmLGr----~D~CM~C~~pLT---Ld~~legkef~~  108 (114)
T PF11023_consen   70 VECPNCGKQTKMLGR----VDACMHCKEPLT---LDPSLEGKEFDE  108 (114)
T ss_pred             eECCCCCChHhhhch----hhccCcCCCcCc---cCchhhcchhhH
Confidence            569999985433221    248999999885   555555444543


No 111
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=80.29  E-value=0.94  Score=42.06  Aligned_cols=43  Identities=21%  Similarity=0.596  Sum_probs=29.5

Q ss_pred             CCCCCCCCCCcee-----E----eCCCCceEeCCCccccccCC---ccccccccc
Q 030241            4 AFCSDCKKHTEVV-----F----DHSAGDTVCSECGLVLESHS---IDETSEWRT   46 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv-----~----D~~~G~~vC~~CG~Vl~e~~---id~~~Ewr~   46 (181)
                      ..||+||....+.     .    ++.+--++|..||..++|+.   ....-+|+.
T Consensus       201 vpCPhCg~~~~l~~~~l~w~~~~~~~~a~y~C~~Cg~~i~e~~k~~m~~~G~Wv~  255 (557)
T PF05876_consen  201 VPCPHCGEEQVLEWENLKWDKGEAPETARYVCPHCGCEIEEHDKRRMVRRGRWVA  255 (557)
T ss_pred             ccCCCCCCCccccccceeecCCCCccceEEECCCCcCCCCHHHHhhccCCeEEEe
Confidence            4699999743332     2    24567899999999999853   233457775


No 112
>PRK08402 replication factor A; Reviewed
Probab=80.20  E-value=1.4  Score=38.79  Aligned_cols=27  Identities=30%  Similarity=0.767  Sum_probs=22.1

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      ..||.|++  .++.|...|...|.+||.|
T Consensus       213 ~aCp~CnK--kv~~~~~~~~~~Ce~~~~v  239 (355)
T PRK08402        213 DACPECRR--KVDYDPATDTWICPEHGEV  239 (355)
T ss_pred             ecCCCCCe--EEEEecCCCCEeCCCCCCc
Confidence            46999986  3555888899999999975


No 113
>KOG1088 consensus Uncharacterized conserved protein [Function unknown]
Probab=79.87  E-value=0.71  Score=34.28  Aligned_cols=17  Identities=41%  Similarity=0.747  Sum_probs=14.9

Q ss_pred             EeCCCCceEeCCCcccc
Q 030241           17 FDHSAGDTVCSECGLVL   33 (181)
Q Consensus        17 ~D~~~G~~vC~~CG~Vl   33 (181)
                      +|-.+|+++|.+||.|.
T Consensus        92 ~~v~EG~l~CpetG~vf  108 (124)
T KOG1088|consen   92 IDVIEGELVCPETGRVF  108 (124)
T ss_pred             hhhccceEecCCCCcEe
Confidence            45678999999999997


No 114
>PF14122 YokU:  YokU-like protein
Probab=79.76  E-value=1.2  Score=31.32  Aligned_cols=23  Identities=26%  Similarity=0.654  Sum_probs=17.7

Q ss_pred             CCceEeCCCccccccCCcccccc
Q 030241           21 AGDTVCSECGLVLESHSIDETSE   43 (181)
Q Consensus        21 ~G~~vC~~CG~Vl~e~~id~~~E   43 (181)
                      +=.++|.+||.|.-+..+..+-|
T Consensus        33 tP~i~C~~CgmvYq~d~vi~EIE   55 (87)
T PF14122_consen   33 TPAIICSNCGMVYQDDEVIKEIE   55 (87)
T ss_pred             CceeeecCCCcEEehhHHHHHHh
Confidence            34489999999998777766555


No 115
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=79.41  E-value=1.2  Score=35.95  Aligned_cols=29  Identities=28%  Similarity=0.560  Sum_probs=20.9

Q ss_pred             CCCCCCCCC-CceeEeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKH-TEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~-~~iv~D~~~G~~vC~~CG~V   32 (181)
                      ..||.|+++ |.++.+...=.+.|..||..
T Consensus        99 V~C~~C~~pdT~l~k~~~~~~l~C~aCGa~  128 (201)
T PRK12336         99 VICSECGLPDTRLVKEDRVLMLRCDACGAH  128 (201)
T ss_pred             EECCCCCCCCcEEEEcCCeEEEEcccCCCC
Confidence            469999985 44655544445689999986


No 116
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=79.22  E-value=1.1  Score=29.58  Aligned_cols=32  Identities=31%  Similarity=0.755  Sum_probs=20.5

Q ss_pred             CCCCCCCCCCCCCceeEeCCCCceEeCCCccccccCCccccccccc
Q 030241            1 MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRT   46 (181)
Q Consensus         1 m~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~~~Ewr~   46 (181)
                      |....|.+|+.   ++ +.    ..|..||-.      +.+.+|..
T Consensus         1 M~~kAC~~C~~---i~-~~----~~CP~Cgs~------~~T~~W~G   32 (61)
T PRK08351          1 MTEKACRHCHY---IT-TE----DRCPVCGSR------DLSDEWFD   32 (61)
T ss_pred             CchhhhhhCCc---cc-CC----CcCCCCcCC------cccccccc
Confidence            66678999986   22 32    269999973      24456643


No 117
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=78.35  E-value=1.1  Score=28.74  Aligned_cols=29  Identities=24%  Similarity=0.566  Sum_probs=21.4

Q ss_pred             CCCCCCCCCCcee--EeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVV--FDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv--~D~~~G~~vC~~CG~V   32 (181)
                      .+|++|.+++-+.  .+.+.-..+|..||..
T Consensus        23 LIC~~C~~hNGla~~~~~~~i~y~C~~Cg~~   53 (54)
T PF10058_consen   23 LICSKCFSHNGLAPKEEFEEIQYRCPYCGAL   53 (54)
T ss_pred             EECcccchhhcccccccCCceEEEcCCCCCc
Confidence            5699998754343  6667778999999863


No 118
>PHA02942 putative transposase; Provisional
Probab=77.89  E-value=1.5  Score=38.93  Aligned_cols=28  Identities=18%  Similarity=0.474  Sum_probs=20.4

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ..||.||. ..  .+.......|.+||.+.+
T Consensus       326 q~Cs~CG~-~~--~~l~~r~f~C~~CG~~~d  353 (383)
T PHA02942        326 VSCPKCGH-KM--VEIAHRYFHCPSCGYEND  353 (383)
T ss_pred             ccCCCCCC-cc--CcCCCCEEECCCCCCEeC
Confidence            57999996 22  244456789999999864


No 119
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=77.60  E-value=0.45  Score=40.83  Aligned_cols=30  Identities=20%  Similarity=0.470  Sum_probs=22.8

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .+||.|+. .-...|-.....||..||.-..
T Consensus        39 ~kc~~C~~-~~~~~~l~~~~~vcp~c~~h~r   68 (296)
T CHL00174         39 VQCENCYG-LNYKKFLKSKMNICEQCGYHLK   68 (296)
T ss_pred             eECCCccc-hhhHHHHHHcCCCCCCCCCCcC
Confidence            57999997 3334455778899999998765


No 120
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=77.52  E-value=1.4  Score=26.48  Aligned_cols=28  Identities=32%  Similarity=0.640  Sum_probs=16.9

Q ss_pred             CCCCCCCCCCceeEeCC-CCceEeCCCcc
Q 030241            4 AFCSDCKKHTEVVFDHS-AGDTVCSECGL   31 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~-~G~~vC~~CG~   31 (181)
                      -+|++||..-++..... .....|..||.
T Consensus         6 y~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSISEDDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEcCCCCCCcCCCCCC
Confidence            35888885223333222 46788888887


No 121
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=77.41  E-value=0.47  Score=40.47  Aligned_cols=30  Identities=17%  Similarity=0.429  Sum_probs=22.2

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .+||+|+. .-...|-.....||..||.-..
T Consensus        27 ~~c~~c~~-~~~~~~l~~~~~vc~~c~~h~r   56 (285)
T TIGR00515        27 TKCPKCGQ-VLYTKELERNLEVCPKCDHHMR   56 (285)
T ss_pred             eECCCCcc-hhhHHHHHhhCCCCCCCCCcCc
Confidence            57999997 3333345677899999998765


No 122
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=77.26  E-value=1.6  Score=27.97  Aligned_cols=28  Identities=25%  Similarity=0.653  Sum_probs=18.4

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCCc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSI   38 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~i   38 (181)
                      ..||+||. ..      ..-.+|.+||+.=+..+|
T Consensus        27 ~~c~~cg~-~~------~~H~vc~~cG~y~~r~v~   54 (56)
T PF01783_consen   27 VKCPNCGE-PK------LPHRVCPSCGYYKGRQVI   54 (56)
T ss_dssp             EESSSSSS-EE------STTSBCTTTBBSSSSSSS
T ss_pred             eeeccCCC-Ee------cccEeeCCCCeECCEEEe
Confidence            46999996 11      345899999966444433


No 123
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=76.82  E-value=0.61  Score=35.61  Aligned_cols=30  Identities=33%  Similarity=0.586  Sum_probs=23.4

Q ss_pred             CCCCCCCCCCCCCceeEeCCCCceEeCCCcccccc
Q 030241            1 MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLES   35 (181)
Q Consensus         1 m~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e   35 (181)
                      |....||.||+  -  |.. +|..+|.+|....++
T Consensus         1 m~l~nC~~Cgk--l--F~~-~~~~iCp~C~~~~e~   30 (137)
T TIGR03826         1 MELANCPKCGR--L--FVK-TGRDVCPSCYEEEER   30 (137)
T ss_pred             CCCccccccch--h--hhh-cCCccCHHHhHHHHH
Confidence            77889999997  2  333 488999999988654


No 124
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=76.14  E-value=2  Score=35.98  Aligned_cols=29  Identities=17%  Similarity=0.450  Sum_probs=21.0

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      ..+||.||+.  +......-...|..||.+.
T Consensus        99 ~~fC~~CG~~--~~~~~~~~~~~C~~c~~~~  127 (256)
T PRK00241         99 HRFCGYCGHP--MHPSKTEWAMLCPHCRERY  127 (256)
T ss_pred             CccccccCCC--CeecCCceeEECCCCCCEE
Confidence            4689999984  3344455668899999764


No 125
>COG1773 Rubredoxin [Energy production and conversion]
Probab=76.12  E-value=2.1  Score=27.62  Aligned_cols=26  Identities=35%  Similarity=0.588  Sum_probs=13.0

Q ss_pred             CCCCCCCCCCCCCceeEeCCCCceEeCCCc
Q 030241            1 MTDAFCSDCKKHTEVVFDHSAGDTVCSECG   30 (181)
Q Consensus         1 m~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG   30 (181)
                      |...+|..||=    |+|++.|+-.|.-|+
T Consensus         1 m~~~~C~~CG~----vYd~e~Gdp~~gi~p   26 (55)
T COG1773           1 MKRWRCSVCGY----VYDPEKGDPRCGIAP   26 (55)
T ss_pred             CCceEecCCce----EeccccCCccCCCCC
Confidence            33445555552    455555555554443


No 126
>PF14952 zf-tcix:  Putative treble-clef, zinc-finger, Zn-binding
Probab=76.04  E-value=1.7  Score=26.68  Aligned_cols=25  Identities=24%  Similarity=0.660  Sum_probs=17.8

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeC--CCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCS--ECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~--~CG~Vl~   34 (181)
                      .+||.||. .    +-.+| +.|.  +|+.|+.
T Consensus        12 rkCp~CGt-~----NG~R~-~~CKN~~C~~~~~   38 (44)
T PF14952_consen   12 RKCPKCGT-Y----NGTRG-LSCKNKSCPQVFN   38 (44)
T ss_pred             ccCCcCcC-c----cCccc-ccccCCccchhhh
Confidence            57999996 2    33444 7787  4998874


No 127
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=75.84  E-value=0.53  Score=30.71  Aligned_cols=26  Identities=38%  Similarity=0.888  Sum_probs=19.5

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCC-Cccccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSE-CGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~-CG~Vl~   34 (181)
                      ...|+.||.  .|-    .++.+|++ ||.+++
T Consensus         8 H~HC~VCg~--aIp----~de~~CSe~C~eil~   34 (64)
T COG4068           8 HRHCVVCGK--AIP----PDEQVCSEECGEILN   34 (64)
T ss_pred             CccccccCC--cCC----CccchHHHHHHHHHH
Confidence            467999996  342    46889985 998874


No 128
>KOG4557 consensus Origin recognition complex, subunit 6 [Replication, recombination and repair]
Probab=75.51  E-value=3.9  Score=33.73  Aligned_cols=49  Identities=14%  Similarity=0.158  Sum_probs=32.1

Q ss_pred             HHHHHHHHhCCchHHHHH-HHHHHHHhh----------hCHHHHHHHHHHHHHHhCCCCc
Q 030241          111 TIATMSDRIGQMRYIRRW-KIKSLVEAE----------IKTHYWLLACTLLVDKKTSHAL  159 (181)
Q Consensus       111 ~I~~ia~~L~Lp~~v~e~-~i~k~a~~~----------l~~~~v~AAclYiACR~~~~p~  159 (181)
                      .|+++|=++|+.+-+.-. ++.+...++          |++-.+.+|++|.|||..+..+
T Consensus        95 ~VrdlaVQfgc~evi~~a~~vl~syk~~lpaT~~~~~D~SrP~ft~aA~~~ack~lKlKV  154 (262)
T KOG4557|consen   95 NVRDLAVQFGCVEVIKSAQNVLSSYKERLPATRRANADFSRPVFTAAAFYLACKKLKLKV  154 (262)
T ss_pred             CHHHHHHHHhHHHHHHHHHHHHHHHHhcCchhhhcCCcccchHHHHHHHHHHHHHHHHhh
Confidence            456666667666655444 333333322          2788999999999999886543


No 129
>PF04161 Arv1:  Arv1-like family ;  InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis. Its action is important in lipid homeostasis, which prevents free sterol toxicity []. Arv1 contains a homology domain (AHD), which consists of an N-terminal cysteine-rich subdomain with a putative zinc-binding motif, followed by a C-terminal subdomain of 33 amino acids. The C-terminal subdomain of the AHD is critical for the protein's function []. In yeast, Arv1p is important for the delivery of an early glycosylphosphatidylinositol GPI intermediate, GlcN-acylPI, to the first mannosyltransferase of GPI synthesis in the ER lumen []. It is important for the traffic of sterol in yeast and in humans. In eukaryotic cells, it may fuction in the sphingolipid metabolic pathway as a transporter of ceramides between the ER and Golgi []. 
Probab=75.46  E-value=1.5  Score=35.58  Aligned_cols=34  Identities=26%  Similarity=0.537  Sum_probs=23.4

Q ss_pred             CCCCCCCCCC-ceeEeCCCC---ceEeCCCccccccCC
Q 030241            4 AFCSDCKKHT-EVVFDHSAG---DTVCSECGLVLESHS   37 (181)
Q Consensus         4 ~~Cp~Cg~~~-~iv~D~~~G---~~vC~~CG~Vl~e~~   37 (181)
                      ++|-+||.+. .+..++..|   -..|.+||.|.|+-+
T Consensus         1 miCIeCg~~v~~Ly~~Ys~~~irLt~C~~C~~vaDkYi   38 (208)
T PF04161_consen    1 MICIECGHPVKSLYRQYSPGNIRLTKCPNCGKVADKYI   38 (208)
T ss_pred             CEeccCCCcchhhhhccCCCcEEEeeccccCCccccee
Confidence            5799999742 234555544   378999999986443


No 130
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=75.31  E-value=2.6  Score=31.82  Aligned_cols=27  Identities=30%  Similarity=0.740  Sum_probs=19.3

Q ss_pred             CCC--CCCCCCceeEeCCCCceEeCCCccccc
Q 030241            5 FCS--DCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         5 ~Cp--~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .||  .|++  .+..+ .+|...|..||..++
T Consensus        20 aC~~~~C~k--Kv~~~-~~~~y~C~~C~~~~~   48 (146)
T PF08646_consen   20 ACPNEKCNK--KVTEN-GDGSYRCEKCNKTVE   48 (146)
T ss_dssp             E-TSTTTS---B-EEE-TTTEEEETTTTEEES
T ss_pred             CCCCccCCC--EeecC-CCcEEECCCCCCcCC
Confidence            499  9997  35555 779999999998863


No 131
>COG3877 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=75.21  E-value=2.8  Score=30.68  Aligned_cols=28  Identities=21%  Similarity=0.535  Sum_probs=22.7

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHS   37 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~   37 (181)
                      .+||.||. ..||+     ++-|..||.-+..+.
T Consensus         7 ~~cPvcg~-~~iVT-----eL~c~~~etTVrg~F   34 (122)
T COG3877           7 NRCPVCGR-KLIVT-----ELKCSNCETTVRGNF   34 (122)
T ss_pred             CCCCcccc-cceeE-----EEecCCCCceEecce
Confidence            57999997 57777     599999999986543


No 132
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=75.05  E-value=1.9  Score=27.67  Aligned_cols=26  Identities=23%  Similarity=0.705  Sum_probs=16.8

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      ..||+||.. .      .---||..||+--+..
T Consensus        27 ~~C~~cG~~-~------~~H~vc~~cG~Y~gr~   52 (55)
T TIGR01031        27 VVCPNCGEF-K------LPHRVCPSCGYYKGRQ   52 (55)
T ss_pred             eECCCCCCc-c------cCeeECCccCeECCEE
Confidence            458888862 2      2347899999654433


No 133
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=74.71  E-value=3.1  Score=26.25  Aligned_cols=32  Identities=28%  Similarity=0.697  Sum_probs=20.2

Q ss_pred             CCCCCCCCCCCcee-EeCCCCc-eEeCCCccccc
Q 030241            3 DAFCSDCKKHTEVV-FDHSAGD-TVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv-~D~~~G~-~vC~~CG~Vl~   34 (181)
                      ...|.+|+.....+ -+...|. ++|..||+-..
T Consensus         3 ~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~   36 (52)
T smart00401        3 GRSCSNCGTTETPLWRRGPSGNKTLCNACGLYYK   36 (52)
T ss_pred             CCCcCCCCCCCCCccccCCCCCCcEeecccHHHH
Confidence            45788888632222 2335565 88888888754


No 134
>PRK12366 replication factor A; Reviewed
Probab=74.52  E-value=2.1  Score=40.48  Aligned_cols=25  Identities=36%  Similarity=0.927  Sum_probs=19.8

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      ..||.|++  .+ .+ ..|...|..||.+
T Consensus       533 ~aCp~Cnk--Kv-~~-~~g~~~C~~c~~~  557 (637)
T PRK12366        533 YLCPNCRK--RV-EE-VDGEYICEFCGEV  557 (637)
T ss_pred             ecccccCe--Ee-Ec-CCCcEECCCCCCC
Confidence            46999986  23 33 5799999999988


No 135
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=74.21  E-value=3.6  Score=27.84  Aligned_cols=31  Identities=23%  Similarity=0.603  Sum_probs=21.4

Q ss_pred             CCCCCCCCCCCcee--EeCCCCceEeCCCcccc
Q 030241            3 DAFCSDCKKHTEVV--FDHSAGDTVCSECGLVL   33 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv--~D~~~G~~vC~~CG~Vl   33 (181)
                      +-.||.|++-..|.  .+...-..-|.+||+.-
T Consensus         8 Ga~CP~C~~~D~i~~~~e~~ve~vECV~CGy~e   40 (71)
T PF09526_consen    8 GAVCPKCQAMDTIMMWRENGVEYVECVECGYTE   40 (71)
T ss_pred             CccCCCCcCccEEEEEEeCCceEEEecCCCCee
Confidence            45799999843333  34445566799999984


No 136
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=74.09  E-value=2  Score=25.27  Aligned_cols=22  Identities=27%  Similarity=0.578  Sum_probs=11.0

Q ss_pred             CCCCCCCCCCceeEeCCCCceEe
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVC   26 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC   26 (181)
                      .+|..||. ---+.+...|.++|
T Consensus         7 YkC~~CGn-iVev~~~g~g~lvC   28 (36)
T PF06397_consen    7 YKCEHCGN-IVEVVHDGGGPLVC   28 (36)
T ss_dssp             EE-TTT---EEEEEE--SS-EEE
T ss_pred             EEccCCCC-EEEEEECCCCCEEe
Confidence            46888986 34456667788888


No 137
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=73.69  E-value=1.8  Score=26.92  Aligned_cols=16  Identities=31%  Similarity=0.665  Sum_probs=10.5

Q ss_pred             eEeCCCccccccCCcc
Q 030241           24 TVCSECGLVLESHSID   39 (181)
Q Consensus        24 ~vC~~CG~Vl~e~~id   39 (181)
                      ..|..||.|.++..=|
T Consensus         2 y~C~~CgyvYd~~~Gd   17 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGD   17 (47)
T ss_dssp             EEETTTSBEEETTTBB
T ss_pred             cCCCCCCEEEcCCcCC
Confidence            4677777777665533


No 138
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=73.33  E-value=1.5  Score=34.45  Aligned_cols=29  Identities=21%  Similarity=0.447  Sum_probs=18.7

Q ss_pred             CCCCCCCCCCCceeEe---------------CCCCceEeCCCcccc
Q 030241            3 DAFCSDCKKHTEVVFD---------------HSAGDTVCSECGLVL   33 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D---------------~~~G~~vC~~CG~Vl   33 (181)
                      ...||+|+.  .++.=               ..+-...|..||.+.
T Consensus        97 ~~RCp~CN~--~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~CgkiY  140 (165)
T COG1656          97 FSRCPECNG--ELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKIY  140 (165)
T ss_pred             cccCcccCC--EeccCcHHHHhhccchhhhhcccceeECCCCcccc
Confidence            368999986  22221               122356799999985


No 139
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=73.22  E-value=2.8  Score=26.40  Aligned_cols=13  Identities=23%  Similarity=0.726  Sum_probs=8.7

Q ss_pred             eEeCCCccccccC
Q 030241           24 TVCSECGLVLESH   36 (181)
Q Consensus        24 ~vC~~CG~Vl~e~   36 (181)
                      .+|..||+|.++.
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            4677777777654


No 140
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription]
Probab=73.01  E-value=2.8  Score=30.20  Aligned_cols=30  Identities=23%  Similarity=0.572  Sum_probs=20.1

Q ss_pred             CCCCCCCCCCceeEeCCC-CceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSA-GDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~-G~~vC~~CG~Vl~   34 (181)
                      ..||.||+ -=+|+..+. ....|..|++|..
T Consensus         2 ~FCP~Cgn-~Live~g~~~~rf~C~tCpY~~~   32 (105)
T KOG2906|consen    2 LFCPTCGN-MLIVESGESCNRFSCRTCPYVFP   32 (105)
T ss_pred             cccCCCCC-EEEEecCCeEeeEEcCCCCceee
Confidence            57999997 333332222 5678999999964


No 141
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=72.61  E-value=3  Score=32.12  Aligned_cols=27  Identities=26%  Similarity=0.722  Sum_probs=20.5

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      ..||.|++ . + .+...|...|..|+..+
T Consensus        35 ~aC~~C~k-k-v-~~~~~~~~~C~~C~~~~   61 (166)
T cd04476          35 PACPGCNK-K-V-VEEGNGTYRCEKCNKSV   61 (166)
T ss_pred             ccccccCc-c-c-EeCCCCcEECCCCCCcC
Confidence            35999997 3 3 34444999999999886


No 142
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=72.48  E-value=1.5  Score=35.31  Aligned_cols=31  Identities=32%  Similarity=0.596  Sum_probs=19.6

Q ss_pred             CCCCCCCCCCcee--EeCCCC---ceEeCCCcccccc
Q 030241            4 AFCSDCKKHTEVV--FDHSAG---DTVCSECGLVLES   35 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv--~D~~~G---~~vC~~CG~Vl~e   35 (181)
                      ..||.||+ -++.  .=-..|   .+-|.+||+|-.+
T Consensus         7 ~~Cp~Cg~-eev~hEVik~~g~~~lvrC~eCG~V~~~   42 (201)
T COG1326           7 IECPSCGS-EEVSHEVIKERGREPLVRCEECGTVHPA   42 (201)
T ss_pred             EECCCCCc-chhhHHHHHhcCCceEEEccCCCcEeec
Confidence            46999995 3320  001234   4779999999854


No 143
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=72.48  E-value=2.3  Score=31.17  Aligned_cols=6  Identities=33%  Similarity=1.160  Sum_probs=3.2

Q ss_pred             EeCCCc
Q 030241           25 VCSECG   30 (181)
Q Consensus        25 vC~~CG   30 (181)
                      .|..||
T Consensus        88 ~CP~Cg   93 (113)
T PRK12380         88 QCPHCH   93 (113)
T ss_pred             cCcCCC
Confidence            355555


No 144
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=72.30  E-value=2.2  Score=28.18  Aligned_cols=34  Identities=32%  Similarity=0.793  Sum_probs=20.7

Q ss_pred             CCCCCCCCCCCCceeEeCCCCceEeCCCccccccCCcccccccccc
Q 030241            2 TDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTF   47 (181)
Q Consensus         2 ~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~~~Ewr~F   47 (181)
                      ....|.+|+.   ++.   ...-+|..||.-      +...||+.+
T Consensus         3 ~~kAC~~Ck~---l~~---~d~e~CP~Cgs~------~~te~W~G~   36 (64)
T COG2093           3 TEKACKNCKR---LTP---EDTEICPVCGST------DLTEEWFGL   36 (64)
T ss_pred             hhHHHhhccc---cCC---CCCccCCCCCCc------ccchhhccE
Confidence            3456889986   222   345689999864      334567543


No 145
>KOG1010 consensus Rb (Retinoblastoma tumor suppressor)-related protein [Cell cycle control, cell division, chromosome partitioning]
Probab=71.08  E-value=9.4  Score=37.24  Aligned_cols=51  Identities=8%  Similarity=0.070  Sum_probs=42.6

Q ss_pred             HHHHHHHHHHhCCchHHHHH--HHHHHHHhh--h--CHHHHHHHHHHHHHHhCCCCc
Q 030241          109 FKTIATMSDRIGQMRYIRRW--KIKSLVEAE--I--KTHYWLLACTLLVDKKTSHAL  159 (181)
Q Consensus       109 ~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~--l--~~~~v~AAclYiACR~~~~p~  159 (181)
                      .+.....|..|+++.....+  +.|..+.++  +  +-.++.|.+||.|||..+.|-
T Consensus        35 ~q~~~~~c~~lnld~~~~~ea~d~yta~~q~~slegs~~hW~~cAlY~~~r~S~~~~   91 (920)
T KOG1010|consen   35 EQDSDELCRPLNLDEQTETEAWDTYTAVSQRLSLEGSESHWLACALYTACRRSSVPT   91 (920)
T ss_pred             hhhhhhhhhhhcccchhhhhhHHHHHHHHhHhCCCccHHHHHHHHHHHHHHhccCCc
Confidence            45677788999999876555  899999888  4  778999999999999998873


No 146
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=70.54  E-value=2.8  Score=30.79  Aligned_cols=18  Identities=11%  Similarity=0.481  Sum_probs=9.3

Q ss_pred             ceeEeCCCCceEeCCCcc
Q 030241           14 EVVFDHSAGDTVCSECGL   31 (181)
Q Consensus        14 ~iv~D~~~G~~vC~~CG~   31 (181)
                      .+..+...+...|.+||.
T Consensus        61 ~L~I~~~p~~~~C~~Cg~   78 (115)
T TIGR00100        61 KLNIEDEPVECECEDCSE   78 (115)
T ss_pred             EEEEEeeCcEEEcccCCC
Confidence            344444555555555553


No 147
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=70.40  E-value=2.7  Score=39.85  Aligned_cols=7  Identities=29%  Similarity=1.118  Sum_probs=3.4

Q ss_pred             CCCCCCC
Q 030241            5 FCSDCKK   11 (181)
Q Consensus         5 ~Cp~Cg~   11 (181)
                      +||+||.
T Consensus         3 ~Cp~Cg~    9 (645)
T PRK14559          3 ICPQCQF    9 (645)
T ss_pred             cCCCCCC
Confidence            4555553


No 148
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=70.04  E-value=3.8  Score=24.32  Aligned_cols=28  Identities=21%  Similarity=0.456  Sum_probs=15.6

Q ss_pred             CCCCCCCCCceeEeC-CCCceEeCCCcccc
Q 030241            5 FCSDCKKHTEVVFDH-SAGDTVCSECGLVL   33 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~-~~G~~vC~~CG~Vl   33 (181)
                      +||.|+.. -..... .---.+|..||=+-
T Consensus         1 ~CP~C~~~-l~~~~~~~~~id~C~~C~G~W   29 (41)
T PF13453_consen    1 KCPRCGTE-LEPVRLGDVEIDVCPSCGGIW   29 (41)
T ss_pred             CcCCCCcc-cceEEECCEEEEECCCCCeEE
Confidence            59999862 111111 11224699998774


No 149
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=70.02  E-value=1.2  Score=28.19  Aligned_cols=31  Identities=16%  Similarity=0.340  Sum_probs=22.3

Q ss_pred             CCCCCCCCCCCCcee-EeCCCCceEeCCCcccc
Q 030241            2 TDAFCSDCKKHTEVV-FDHSAGDTVCSECGLVL   33 (181)
Q Consensus         2 ~~~~Cp~Cg~~~~iv-~D~~~G~~vC~~CG~Vl   33 (181)
                      ...+|++|+.- =.. -+....++-|.-||.+-
T Consensus         3 ~eiRC~~Cnkl-La~~g~~~~leIKCpRC~tiN   34 (51)
T PF10122_consen    3 KEIRCGHCNKL-LAKAGEVIELEIKCPRCKTIN   34 (51)
T ss_pred             cceeccchhHH-HhhhcCccEEEEECCCCCccc
Confidence            45789999862 111 24567899999999995


No 150
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=70.02  E-value=3.6  Score=29.92  Aligned_cols=11  Identities=36%  Similarity=0.752  Sum_probs=8.2

Q ss_pred             ceEeCCCcccc
Q 030241           23 DTVCSECGLVL   33 (181)
Q Consensus        23 ~~vC~~CG~Vl   33 (181)
                      -.+|.+||.++
T Consensus        31 ~~~C~~CGe~~   41 (127)
T TIGR03830        31 GWYCPACGEEL   41 (127)
T ss_pred             eeECCCCCCEE
Confidence            34788898875


No 151
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=69.60  E-value=2.6  Score=24.39  Aligned_cols=21  Identities=43%  Similarity=1.054  Sum_probs=11.3

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECG   30 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG   30 (181)
                      .+|++||.   +.+-+.   .+|..||
T Consensus        12 ~rC~~Cg~---~~~pPr---~~Cp~C~   32 (37)
T PF12172_consen   12 QRCRDCGR---VQFPPR---PVCPHCG   32 (37)
T ss_dssp             EE-TTT-----EEES-----SEETTTT
T ss_pred             EEcCCCCC---EecCCC---cCCCCcC
Confidence            46888886   334333   7888887


No 152
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=68.47  E-value=4.8  Score=28.60  Aligned_cols=28  Identities=25%  Similarity=0.578  Sum_probs=19.5

Q ss_pred             CCCCCCCCCCceeEe---------CCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFD---------HSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D---------~~~G~~vC~~CG~V   32 (181)
                      ..||.||. ...++-         +.+=..+|.+||..
T Consensus        63 ~~Cp~Cg~-~~a~f~~~Q~RsadE~~T~fy~C~~C~~~   99 (104)
T TIGR01384        63 VECPKCGH-KEAYYWLLQTRRADEPETRFYKCTKCGYV   99 (104)
T ss_pred             CCCCCCCC-CeeEEEEeccCCCCCCcEEEEEeCCCCCe
Confidence            57999997 555443         23346789999974


No 153
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=68.00  E-value=4.2  Score=21.73  Aligned_cols=23  Identities=26%  Similarity=0.787  Sum_probs=13.0

Q ss_pred             CCCCCCCCceeEeCC-CCceEeCCCcc
Q 030241            6 CSDCKKHTEVVFDHS-AGDTVCSECGL   31 (181)
Q Consensus         6 Cp~Cg~~~~iv~D~~-~G~~vC~~CG~   31 (181)
                      |..||.  .| ...+ .-...|.+||.
T Consensus         1 C~sC~~--~i-~~r~~~v~f~CPnCG~   24 (24)
T PF07754_consen    1 CTSCGR--PI-APREQAVPFPCPNCGF   24 (24)
T ss_pred             CccCCC--cc-cCcccCceEeCCCCCC
Confidence            566764  22 2222 44577888883


No 154
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=67.19  E-value=1.5  Score=37.30  Aligned_cols=30  Identities=20%  Similarity=0.490  Sum_probs=22.4

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .+||.||. .-..-|-.+...||..||.-..
T Consensus        29 ~KCp~c~~-~~y~~eL~~n~~vcp~c~~h~r   58 (294)
T COG0777          29 TKCPSCGE-MLYRKELESNLKVCPKCGHHMR   58 (294)
T ss_pred             eECCCccc-eeeHHHHHhhhhcccccCcccc
Confidence            47999996 3333345778899999998754


No 155
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=67.00  E-value=4.2  Score=24.96  Aligned_cols=28  Identities=18%  Similarity=0.484  Sum_probs=17.1

Q ss_pred             CCCCCCCCCceeEeC-------CCCceEeCC--Ccccc
Q 030241            5 FCSDCKKHTEVVFDH-------SAGDTVCSE--CGLVL   33 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~-------~~G~~vC~~--CG~Vl   33 (181)
                      +||+||+. ..+.-.       .+-...|++  ||.-.
T Consensus         1 ~CP~Cg~~-a~ir~S~~~s~~~~~~Y~qC~N~~Cg~tf   37 (47)
T PF04606_consen    1 RCPHCGSK-ARIRTSRQLSPLTRELYCQCTNPECGHTF   37 (47)
T ss_pred             CcCCCCCe-eEEEEchhhCcceEEEEEEECCCcCCCEE
Confidence            59999973 333321       334457777  88764


No 156
>KOG0402 consensus 60S ribosomal protein L37 [Translation, ribosomal structure and biogenesis]
Probab=66.97  E-value=1.8  Score=30.32  Aligned_cols=30  Identities=30%  Similarity=0.488  Sum_probs=24.3

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ...|+.||. . -+-...-|-.-|..|..|+.
T Consensus        36 ky~CsfCGK-~-~vKR~AvGiW~C~~C~kv~a   65 (92)
T KOG0402|consen   36 KYTCSFCGK-K-TVKRKAVGIWKCGSCKKVVA   65 (92)
T ss_pred             hhhhhhcch-h-hhhhhceeEEecCCccceec
Confidence            357999997 3 45667889999999999974


No 157
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=66.53  E-value=3.8  Score=31.01  Aligned_cols=21  Identities=24%  Similarity=0.629  Sum_probs=14.4

Q ss_pred             ceeEeCCCCceEeCCCccccc
Q 030241           14 EVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus        14 ~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .++++...+...|.+||.+..
T Consensus        61 ~L~i~~~p~~~~C~~CG~~~~   81 (135)
T PRK03824         61 EIIFEEEEAVLKCRNCGNEWS   81 (135)
T ss_pred             EEEEEecceEEECCCCCCEEe
Confidence            455566667788888886653


No 158
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=65.56  E-value=3.4  Score=30.46  Aligned_cols=33  Identities=12%  Similarity=0.128  Sum_probs=26.2

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccccCCc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSI   38 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~i   38 (181)
                      +++||+||++   .+|-.+--+||.-||.-.-.+.+
T Consensus         9 KridPetg~K---FYDLNrdPiVsPytG~s~P~s~f   41 (129)
T COG4530           9 KRIDPETGKK---FYDLNRDPIVSPYTGKSYPRSYF   41 (129)
T ss_pred             cccCccccch---hhccCCCccccCcccccchHHHH
Confidence            4789999983   47888999999999987654443


No 159
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=65.22  E-value=4.9  Score=35.87  Aligned_cols=30  Identities=27%  Similarity=0.607  Sum_probs=15.4

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .||+|+.-.....-.......|..||.++.
T Consensus        15 ~C~~Cd~l~~~~~l~~g~~a~CpRCg~~L~   44 (403)
T TIGR00155        15 LCSQCDMLVALPRIESGQKAACPRCGTTLT   44 (403)
T ss_pred             eCCCCCCcccccCCCCCCeeECCCCCCCCc
Confidence            477777521111111333456777777773


No 160
>TIGR00569 ccl1 cyclin ccl1. University).
Probab=64.83  E-value=27  Score=30.11  Aligned_cols=23  Identities=13%  Similarity=0.072  Sum_probs=20.6

Q ss_pred             CHHHHHHHHHHHHHHhCCCCccc
Q 030241          139 KTHYWLLACTLLVDKKTSHALLR  161 (181)
Q Consensus       139 ~~~~v~AAclYiACR~~~~p~t~  161 (181)
                      .+..+++||||+|+|..+.++.+
T Consensus       204 ~Ps~IAlAAI~lA~~~~~~~l~~  226 (305)
T TIGR00569       204 TPSQIALAAILHTASRAGLNMES  226 (305)
T ss_pred             CHHHHHHHHHHHHHHHhCCCCcc
Confidence            89999999999999999987653


No 161
>KOG3134 consensus Predicted membrane protein [Function unknown]
Probab=64.78  E-value=1.9  Score=35.40  Aligned_cols=34  Identities=24%  Similarity=0.458  Sum_probs=26.3

Q ss_pred             CCCCCCCCC-CceeEeCCCC---ceEeCCCccccccCC
Q 030241            4 AFCSDCKKH-TEVVFDHSAG---DTVCSECGLVLESHS   37 (181)
Q Consensus         4 ~~Cp~Cg~~-~~iv~D~~~G---~~vC~~CG~Vl~e~~   37 (181)
                      ++|-+||+. ..+-.++..|   -+.|.+|+.|+++-+
T Consensus         1 ~~CVeCg~~vksLy~~Ys~g~irlt~C~nC~e~vDkYi   38 (225)
T KOG3134|consen    1 YRCVECGSEVKSLYTQYSPGNIRLTKCPNCQEVVDKYI   38 (225)
T ss_pred             CcccccCchHHHHHHhcCCCcEEEeeCCchhhHHHhHe
Confidence            469999974 3466777888   578999999987554


No 162
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=64.53  E-value=4.1  Score=34.06  Aligned_cols=30  Identities=20%  Similarity=0.610  Sum_probs=11.4

Q ss_pred             CCCCCCCCCCceeE---eCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVF---DHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~---D~~~G~~vC~~CG~Vl~   34 (181)
                      ++||+||+ ..+-.   +..-.|-.|.+|+.-.|
T Consensus        32 ~yCP~Cg~-~~L~~f~NN~PVaDF~C~~C~eeyE   64 (254)
T PF06044_consen   32 MYCPNCGS-KPLSKFENNRPVADFYCPNCNEEYE   64 (254)
T ss_dssp             ---TTT---SS-EE--------EEE-TTT--EEE
T ss_pred             CcCCCCCC-hhHhhccCCCccceeECCCCchHHh
Confidence            57999998 43322   22456789999987655


No 163
>PRK05508 methionine sulfoxide reductase B; Provisional
Probab=64.17  E-value=6.3  Score=29.39  Aligned_cols=33  Identities=27%  Similarity=0.616  Sum_probs=27.1

Q ss_pred             eCCCCceEeCCCccccc--cCCccccccccccccC
Q 030241           18 DHSAGDTVCSECGLVLE--SHSIDETSEWRTFANE   50 (181)
Q Consensus        18 D~~~G~~vC~~CG~Vl~--e~~id~~~Ewr~F~~~   50 (181)
                      ..+.|.++|..||.-|=  +.-.|++.-|.+|.+.
T Consensus        28 ~~~~G~Y~C~~Cg~pLF~S~~KfdSg~GWPSF~~~   62 (119)
T PRK05508         28 FFEKGTYVCKQCGAPLYRSEDKFKSGCGWPSFDDE   62 (119)
T ss_pred             cCCCeEEEecCCCCccccccccccCCCCCcccCcc
Confidence            45899999999999874  4557889999999853


No 164
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=64.07  E-value=1.8  Score=31.63  Aligned_cols=24  Identities=33%  Similarity=0.747  Sum_probs=11.1

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      +|+.||.    .++.......|+.||.-
T Consensus        72 ~C~~Cg~----~~~~~~~~~~CP~Cgs~   95 (113)
T PF01155_consen   72 RCRDCGH----EFEPDEFDFSCPRCGSP   95 (113)
T ss_dssp             EETTTS-----EEECHHCCHH-SSSSSS
T ss_pred             ECCCCCC----EEecCCCCCCCcCCcCC
Confidence            4666664    12333333556666654


No 165
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=64.02  E-value=3.5  Score=37.04  Aligned_cols=32  Identities=28%  Similarity=0.675  Sum_probs=23.7

Q ss_pred             CCCCCCCCCCC-----ceeEeCCCCceEeCCCccccc
Q 030241            3 DAFCSDCKKHT-----EVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~-----~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ...||.|++.-     .=++|..+|.-.|..||.=|.
T Consensus       128 ~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~gelv  164 (436)
T KOG2593|consen  128 GYVCPNCQKKYTSLEALQLLDNETGEFHCENCGGELV  164 (436)
T ss_pred             cccCCccccchhhhHHHHhhcccCceEEEecCCCchh
Confidence            35799999731     123577899999999997554


No 166
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=63.53  E-value=5.7  Score=22.52  Aligned_cols=23  Identities=26%  Similarity=0.540  Sum_probs=12.9

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCS   27 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~   27 (181)
                      .+|..||. --.+.+...|+++|-
T Consensus         8 ykC~~Cgn-iv~v~~~~~~~l~Cc   30 (34)
T TIGR00319         8 YKCEVCGN-IVEVLHAGGGQLVCC   30 (34)
T ss_pred             EEcCCCCc-EEEEEECCCcceecc
Confidence            35777775 334445555666664


No 167
>PF08063 PADR1:  PADR1 (NUC008) domain;  InterPro: IPR012982 This domain is found in poly(ADP-ribose)-synthetases []. The function of this domain is unknown.; GO: 0003950 NAD+ ADP-ribosyltransferase activity, 0005634 nucleus; PDB: 2JVN_A 4DQY_E 2RIQ_A.
Probab=63.52  E-value=4.4  Score=25.93  Aligned_cols=21  Identities=33%  Similarity=0.722  Sum_probs=14.2

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCS   27 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~   27 (181)
                      ..||.|++ ..+++|..  .+.|+
T Consensus        15 ~~Cp~C~~-~~l~~~~~--~Y~C~   35 (55)
T PF08063_consen   15 EPCPKCKG-GQLYFDGS--GYKCT   35 (55)
T ss_dssp             ---SSSSE--EEEEETT--EEEEE
T ss_pred             CCCCCCCC-CeEEecCC--ccEeC
Confidence            47999997 78888855  78887


No 168
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=63.49  E-value=6.5  Score=22.55  Aligned_cols=8  Identities=38%  Similarity=1.012  Sum_probs=4.5

Q ss_pred             eEeCCCcc
Q 030241           24 TVCSECGL   31 (181)
Q Consensus        24 ~vC~~CG~   31 (181)
                      .+|.-||.
T Consensus        19 ~~CP~Cg~   26 (34)
T cd00729          19 EKCPICGA   26 (34)
T ss_pred             CcCcCCCC
Confidence            45666654


No 169
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=63.48  E-value=6.1  Score=36.23  Aligned_cols=29  Identities=21%  Similarity=0.647  Sum_probs=23.6

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ..||+|+.  .+++...++.+.|.-||....
T Consensus       223 ~~C~~C~~--~l~~h~~~~~l~Ch~Cg~~~~  251 (505)
T TIGR00595       223 LCCPNCDV--SLTYHKKEGKLRCHYCGYQEP  251 (505)
T ss_pred             cCCCCCCC--ceEEecCCCeEEcCCCcCcCC
Confidence            46999985  577877889999999998864


No 170
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=63.40  E-value=5.7  Score=22.57  Aligned_cols=24  Identities=25%  Similarity=0.490  Sum_probs=14.6

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSE   28 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~   28 (181)
                      .+|..||. --.+.+...|+++|-.
T Consensus         5 ykC~~CGn-iv~v~~~~~~~l~Ccg   28 (34)
T cd00974           5 YKCEICGN-IVEVLNVGGGTLVCCG   28 (34)
T ss_pred             EEcCCCCc-EEEEEECCCcceeecC
Confidence            46777775 3444555666677753


No 171
>PF01599 Ribosomal_S27:  Ribosomal protein S27a;  InterPro: IPR002906 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family of ribosomal proteins consists mainly of the 40S ribosomal protein S27a which is synthesized as a C-terminal extension of ubiquitin (CEP) (IPR000626 from INTERPRO). The S27a domain compromises the C-terminal half of the protein. The synthesis of ribosomal proteins as extensions of ubiquitin promotes their incorporation into nascent ribosomes by a transient metabolic stabilisation and is required for efficient ribosome biogenesis []. The ribosomal extension protein S27a contains a basic region that is proposed to form a zinc finger; its fusion gene is proposed as a mechanism to maintain a fixed ratio between ubiquitin necessary for degrading proteins and ribosomes a source of proteins [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2K4X_A 3U5C_f 3U5G_f 2XZN_9 2XZM_9.
Probab=63.38  E-value=9.1  Score=23.83  Aligned_cols=26  Identities=23%  Similarity=0.663  Sum_probs=18.6

Q ss_pred             CCCC--CCCCCCceeEeCCCCceEeCCCcc
Q 030241            4 AFCS--DCKKHTEVVFDHSAGDTVCSECGL   31 (181)
Q Consensus         4 ~~Cp--~Cg~~~~iv~D~~~G~~vC~~CG~   31 (181)
                      ..||  .||. ..+..++.+ -.-|..||+
T Consensus        19 k~CP~~~CG~-GvFMA~H~d-R~~CGKCg~   46 (47)
T PF01599_consen   19 KECPSPRCGA-GVFMAEHKD-RHYCGKCGY   46 (47)
T ss_dssp             EE-TSTTTTS-SSEEEE-SS-EEEETTTSS
T ss_pred             hcCCCcccCC-ceEeeecCC-CccCCCccc
Confidence            4699  9997 666777754 788999986


No 172
>PF14768 RPA_interact_C:  Replication protein A interacting C-terminal
Probab=62.88  E-value=5.9  Score=27.27  Aligned_cols=26  Identities=31%  Similarity=0.724  Sum_probs=19.8

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .||.|.. .++..  ..+.+.| .||+-|.
T Consensus         1 iCPVC~~-~~L~~--~~~~i~C-~Cgl~l~   26 (82)
T PF14768_consen    1 ICPVCQK-GNLRE--NSNVISC-SCGLRLN   26 (82)
T ss_pred             CCCccCC-Ccccc--cCCeEEC-CCccEEe
Confidence            5999997 67655  5788999 6776664


No 173
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=62.86  E-value=6.9  Score=33.83  Aligned_cols=10  Identities=40%  Similarity=1.105  Sum_probs=5.2

Q ss_pred             eEeCCCcccc
Q 030241           24 TVCSECGLVL   33 (181)
Q Consensus        24 ~vC~~CG~Vl   33 (181)
                      .+|.+|+.-+
T Consensus       253 e~C~~C~~Yl  262 (309)
T PRK03564        253 ESCGDCGTYL  262 (309)
T ss_pred             eecccccccc
Confidence            4555555544


No 174
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=62.82  E-value=4.3  Score=38.54  Aligned_cols=24  Identities=21%  Similarity=0.632  Sum_probs=15.1

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .||+||..      -..|...|.+||.-+.
T Consensus        29 ~Cp~CG~~------~~~~~~fC~~CG~~~~   52 (645)
T PRK14559         29 PCPQCGTE------VPVDEAHCPNCGAETG   52 (645)
T ss_pred             cCCCCCCC------CCcccccccccCCccc
Confidence            46666641      2356778888887654


No 175
>PRK05580 primosome assembly protein PriA; Validated
Probab=62.45  E-value=6.5  Score=37.41  Aligned_cols=29  Identities=21%  Similarity=0.516  Sum_probs=23.6

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .+||+|+.  .+++....+.+.|..||....
T Consensus       391 ~~C~~C~~--~l~~h~~~~~l~Ch~Cg~~~~  419 (679)
T PRK05580        391 AECPHCDA--SLTLHRFQRRLRCHHCGYQEP  419 (679)
T ss_pred             cCCCCCCC--ceeEECCCCeEECCCCcCCCC
Confidence            46999985  578888889999999998753


No 176
>KOG1010 consensus Rb (Retinoblastoma tumor suppressor)-related protein [Cell cycle control, cell division, chromosome partitioning]
Probab=62.07  E-value=15  Score=35.84  Aligned_cols=54  Identities=15%  Similarity=0.146  Sum_probs=45.0

Q ss_pred             HHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh---h----CHHHHHHHHHHHHHHhCCCCcc
Q 030241          107 LAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE---I----KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       107 ~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~---l----~~~~v~AAclYiACR~~~~p~t  160 (181)
                      -|..+|+.+|++|.|.+...+.  .+|.-....   |    ..+.+.-.|+|+.||..+..+|
T Consensus       679 LAavRL~~Lc~rL~l~~e~r~~IWtlFehsl~~et~Lm~dRHLDQillCaiy~i~KV~~~~lt  741 (920)
T KOG1010|consen  679 LAAVRLNDLCERLSLSDELREQIWTLFEHSLTNETELMRDRHLDQILLCAIYGIAKVKKEDLT  741 (920)
T ss_pred             HHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHhccHHHHHhhhHHHHHHHHHHhheehhcccch
Confidence            4888999999999999987777  677765443   3    7899999999999999987766


No 177
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=60.91  E-value=5.3  Score=29.28  Aligned_cols=16  Identities=13%  Similarity=0.569  Sum_probs=7.3

Q ss_pred             eeEeCCCCceEeCCCc
Q 030241           15 VVFDHSAGDTVCSECG   30 (181)
Q Consensus        15 iv~D~~~G~~vC~~CG   30 (181)
                      +..+...+...|.+||
T Consensus        62 L~i~~~p~~~~C~~Cg   77 (114)
T PRK03681         62 LHLEEQEAECWCETCQ   77 (114)
T ss_pred             EEEEeeCcEEEcccCC
Confidence            3344444444444444


No 178
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=60.89  E-value=8.8  Score=26.44  Aligned_cols=26  Identities=15%  Similarity=0.356  Sum_probs=19.1

Q ss_pred             CCCCCCCCCCceeEeCCCC--ceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAG--DTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G--~~vC~~CG~V   32 (181)
                      ..||-||. .  +++...+  .-||.-|+.-
T Consensus         2 ~~CPCCg~-~--Tl~~~~~~~ydIC~VC~WE   29 (78)
T PF14206_consen    2 YPCPCCGY-Y--TLEERGEGTYDICPVCFWE   29 (78)
T ss_pred             ccCCCCCc-E--EeccCCCcCceECCCCCcc
Confidence            47999996 3  3444444  8899999976


No 179
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=60.81  E-value=7.6  Score=33.51  Aligned_cols=32  Identities=25%  Similarity=0.605  Sum_probs=16.4

Q ss_pred             CCCCCCCCCCCceeE---eC---CCCc--eEeCCCccccc
Q 030241            3 DAFCSDCKKHTEVVF---DH---SAGD--TVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~---D~---~~G~--~vC~~CG~Vl~   34 (181)
                      ..+||+||+...+.+   |.   ..+.  .+|.+|+.-+.
T Consensus       224 R~~C~~Cg~~~~l~y~~~e~~~~~~~~r~e~C~~C~~YlK  263 (305)
T TIGR01562       224 RVKCSHCEESKHLAYLSLEHDAEKAVLKAETCDSCQGYLK  263 (305)
T ss_pred             CccCCCCCCCCceeeEeecCCCCCcceEEeeccccccchh
Confidence            456888876332211   21   0111  27888877663


No 180
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=60.76  E-value=3.6  Score=27.32  Aligned_cols=20  Identities=25%  Similarity=0.697  Sum_probs=13.9

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGL   31 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~   31 (181)
                      ..|.+|+.   ++ +    +.+|..||-
T Consensus         6 ~AC~~C~~---i~-~----~~~Cp~Cgs   25 (64)
T PRK06393          6 RACKKCKR---LT-P----EKTCPVHGD   25 (64)
T ss_pred             hhHhhCCc---cc-C----CCcCCCCCC
Confidence            56889986   32 2    238999987


No 181
>PF14353 CpXC:  CpXC protein
Probab=60.44  E-value=8  Score=28.48  Aligned_cols=12  Identities=25%  Similarity=0.758  Sum_probs=9.6

Q ss_pred             ceEeCCCccccc
Q 030241           23 DTVCSECGLVLE   34 (181)
Q Consensus        23 ~~vC~~CG~Vl~   34 (181)
                      ..+|..||....
T Consensus        38 ~~~CP~Cg~~~~   49 (128)
T PF14353_consen   38 SFTCPSCGHKFR   49 (128)
T ss_pred             EEECCCCCCcee
Confidence            578999998763


No 182
>KOG2907 consensus RNA polymerase I transcription factor TFIIS, subunit A12.2/RPA12 [Transcription]
Probab=60.23  E-value=3.6  Score=30.32  Aligned_cols=32  Identities=22%  Similarity=0.487  Sum_probs=22.4

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      ...|+.||+  -+..-...+..+|..|+.+..-.
T Consensus         7 ~~FC~~CG~--ll~~~~~~~~~~C~~Ck~~~~v~   38 (116)
T KOG2907|consen    7 LDFCSDCGS--LLEEPSAQSTVLCIRCKIEYPVS   38 (116)
T ss_pred             cchhhhhhh--hcccccccCceEeccccccCCHH
Confidence            467999996  23333467777799999887533


No 183
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=60.12  E-value=3.3  Score=26.38  Aligned_cols=29  Identities=38%  Similarity=0.904  Sum_probs=14.8

Q ss_pred             CCCCCCCCceeEe--CCCCceEeCCCccccc
Q 030241            6 CSDCKKHTEVVFD--HSAGDTVCSECGLVLE   34 (181)
Q Consensus         6 Cp~Cg~~~~iv~D--~~~G~~vC~~CG~Vl~   34 (181)
                      |.+|+.......-  +..+...|..||+-..
T Consensus         2 C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~   32 (54)
T cd00202           2 CSNCGTTTTPLWRRGPSGGSTLCNACGLYWK   32 (54)
T ss_pred             CCCCCCCCCcccccCCCCcchHHHHHHHHHH
Confidence            6666652111111  2356667777776653


No 184
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=59.80  E-value=6.1  Score=35.50  Aligned_cols=32  Identities=22%  Similarity=0.608  Sum_probs=19.2

Q ss_pred             CCCCCCCCCCceeEeCCCC-ceEeCCCccccccC
Q 030241            4 AFCSDCKKHTEVVFDHSAG-DTVCSECGLVLESH   36 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G-~~vC~~CG~Vl~e~   36 (181)
                      ..||+|+.... +.+-..| ...|..||.++..+
T Consensus        11 ~~C~~Cd~l~~-~~~l~~g~~a~CpRCg~~L~~~   43 (419)
T PRK15103         11 ILCPQCDMLVA-LPRLEHGQKAACPRCGTTLTVR   43 (419)
T ss_pred             ccCCCCCceee-cCCCCCCCeeECCCCCCCCcCC
Confidence            45999986211 1222333 46799999998533


No 185
>PRK14873 primosome assembly protein PriA; Provisional
Probab=59.37  E-value=7.2  Score=37.15  Aligned_cols=27  Identities=26%  Similarity=0.615  Sum_probs=21.8

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      .+||+|+.  .+++...++.+.|.-||..
T Consensus       393 ~~C~~C~~--~L~~h~~~~~l~Ch~CG~~  419 (665)
T PRK14873        393 ARCRHCTG--PLGLPSAGGTPRCRWCGRA  419 (665)
T ss_pred             eECCCCCC--ceeEecCCCeeECCCCcCC
Confidence            56999985  5777667888999999985


No 186
>PRK07218 replication factor A; Provisional
Probab=59.17  E-value=4.2  Score=36.65  Aligned_cols=21  Identities=24%  Similarity=0.689  Sum_probs=16.1

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      .+||+|+..  +  +    ..+|.+||.|
T Consensus       298 ~rCP~C~r~--v--~----~~~C~~hG~v  318 (423)
T PRK07218        298 ERCPECGRV--I--Q----KGQCRSHGAV  318 (423)
T ss_pred             ecCcCcccc--c--c----CCcCCCCCCc
Confidence            579999972  2  2    2699999988


No 187
>PF04502 DUF572:  Family of unknown function (DUF572) ;  InterPro: IPR007590 This entry represents eukaryotic proteins with undetermined function belonging to the CWC16 family.
Probab=59.11  E-value=4.7  Score=34.88  Aligned_cols=25  Identities=24%  Similarity=0.380  Sum_probs=19.6

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSE   28 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~   28 (181)
                      ++|+.|+..-.|-+||.+++++|..
T Consensus        78 ~kC~~C~~~i~~kTDPkn~dY~~~~  102 (324)
T PF04502_consen   78 IKCPRCSNEIEFKTDPKNTDYVVES  102 (324)
T ss_pred             EEcCCCCCEEeeecCCCCCCeeeec
Confidence            5799998755677888888888776


No 188
>PRK04023 DNA polymerase II large subunit; Validated
Probab=59.05  E-value=7.1  Score=38.81  Aligned_cols=11  Identities=27%  Similarity=0.685  Sum_probs=6.0

Q ss_pred             eEeCCCccccc
Q 030241           24 TVCSECGLVLE   34 (181)
Q Consensus        24 ~vC~~CG~Vl~   34 (181)
                      ..|.+||..+.
T Consensus       664 y~CPKCG~El~  674 (1121)
T PRK04023        664 DECEKCGREPT  674 (1121)
T ss_pred             CcCCCCCCCCC
Confidence            44555665554


No 189
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=58.87  E-value=12  Score=22.12  Aligned_cols=30  Identities=23%  Similarity=0.541  Sum_probs=18.2

Q ss_pred             CCCCCCCCCC--CceeEeCCCCceEeCCCccc
Q 030241            3 DAFCSDCKKH--TEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         3 ~~~Cp~Cg~~--~~iv~D~~~G~~vC~~CG~V   32 (181)
                      +.+|..|+.-  .-..+|......+|.-||..
T Consensus         2 p~rC~~C~aylNp~~~~~~~~~~w~C~~C~~~   33 (40)
T PF04810_consen    2 PVRCRRCRAYLNPFCQFDDGGKTWICNFCGTK   33 (40)
T ss_dssp             S-B-TTT--BS-TTSEEETTTTEEEETTT--E
T ss_pred             ccccCCCCCEECCcceEcCCCCEEECcCCCCc
Confidence            5689999863  23567777788999999985


No 190
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=58.70  E-value=7.3  Score=25.08  Aligned_cols=24  Identities=29%  Similarity=0.755  Sum_probs=18.2

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      .||.|+...     ...-...|.+||...
T Consensus         1 ~Cpv~~~~~-----~~~v~~~Cp~cGipt   24 (55)
T PF13824_consen    1 LCPVCKKDL-----PAHVNFECPDCGIPT   24 (55)
T ss_pred             CCCCCcccc-----ccccCCcCCCCCCcC
Confidence            499999721     455568899999986


No 191
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=58.06  E-value=9.2  Score=27.68  Aligned_cols=30  Identities=20%  Similarity=0.526  Sum_probs=22.0

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      ..|--|+. .-..  .+.+++||..||.++.-.
T Consensus        36 daCeiC~~-~GY~--q~g~~lvC~~C~~~~~~~   65 (102)
T PF10080_consen   36 DACEICGP-KGYY--QEGDQLVCKNCGVRFNLP   65 (102)
T ss_pred             EeccccCC-CceE--EECCEEEEecCCCEEehh
Confidence            35889986 3333  457899999999998533


No 192
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=57.64  E-value=3.3  Score=26.10  Aligned_cols=28  Identities=29%  Similarity=0.652  Sum_probs=18.7

Q ss_pred             CCCCCCCCCcee--EeCCCCceEeCCCcccc
Q 030241            5 FCSDCKKHTEVV--FDHSAGDTVCSECGLVL   33 (181)
Q Consensus         5 ~Cp~Cg~~~~iv--~D~~~G~~vC~~CG~Vl   33 (181)
                      .|+-||..-.+.  +..++| +||.+|--=+
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            489999732211  235778 7999998555


No 193
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=57.13  E-value=6.7  Score=25.44  Aligned_cols=25  Identities=24%  Similarity=0.727  Sum_probs=16.5

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLES   35 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e   35 (181)
                      ..||+||. .-+      ---||.+||.--+.
T Consensus        28 ~~c~~cG~-~~l------~Hrvc~~cg~Y~g~   52 (57)
T COG0333          28 SVCPNCGE-YKL------PHRVCLKCGYYKGR   52 (57)
T ss_pred             eeccCCCC-ccc------CceEcCCCCCccCe
Confidence            56888886 222      24789999965443


No 194
>PF02984 Cyclin_C:  Cyclin, C-terminal domain;  InterPro: IPR004367 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs). Cyclins, together with the p34 (cdc2) or cdk2 kinases, form the Maturation Promoting Factor (MPF). There are two main groups of cyclins, G1/S cyclins, which are essential for the control of the cell cycle at the G1/S (start) transition, and G2/M cyclins, which are essential for the control of the cell cycle at the G2/M (mitosis) transition. G2/M cyclins accumulate steadily during G2 and are abruptly destroyed as cells exit from mitosis (at the end of the M-phase). In most species, there are multiple forms of G1 and G2 cyclins. For example, in vertebrates, there are two G2 cyclins, A and B, and at least three G1 cyclins, C, D, and E. Cyclin homologues have been found in various viruses, including Saimiriine herpesvirus 2 (Herpesvirus saimiri) and Human herpesvirus 8 (HHV-8) (Kaposi's sarcoma-associated herpesvirus). These viral homologues differ from their cellular counterparts in that the viral proteins have gained new functions and eliminated others to harness the cell and benefit the virus []. This is the C-terminal domain of cyclins.; GO: 0005634 nucleus; PDB: 3QHR_D 3QHW_B 1W98_B 1URC_D 2WMB_D 1H26_D 1GY3_B 2UUE_D 1E9H_D 2IW9_D ....
Probab=57.08  E-value=26  Score=24.36  Aligned_cols=19  Identities=21%  Similarity=0.088  Sum_probs=16.0

Q ss_pred             CHHHHHHHHHHHHHHhCCC
Q 030241          139 KTHYWLLACTLLVDKKTSH  157 (181)
Q Consensus       139 ~~~~v~AAclYiACR~~~~  157 (181)
                      +...++|||+|+|.+..+.
T Consensus        41 ~PS~iAaAai~lA~~~~~~   59 (118)
T PF02984_consen   41 PPSVIAAAAILLARKILGK   59 (118)
T ss_dssp             -HHHHHHHHHHHHHHHHHS
T ss_pred             CHHHHHHHHHHHHHHHhCc
Confidence            8999999999999998653


No 195
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=56.56  E-value=8.8  Score=27.14  Aligned_cols=34  Identities=26%  Similarity=0.671  Sum_probs=21.3

Q ss_pred             CCCCCCCC------CceeEeCCCC----------ceEeCCCccccccCCc
Q 030241            5 FCSDCKKH------TEVVFDHSAG----------DTVCSECGLVLESHSI   38 (181)
Q Consensus         5 ~Cp~Cg~~------~~iv~D~~~G----------~~vC~~CG~Vl~e~~i   38 (181)
                      .|+-|+..      +.+.+|...|          -++|..||.+.-+.-+
T Consensus         1 ~C~~C~~~~~~~~~tTv~~el~~G~~~IvIknVPa~~C~~CGe~y~~dev   50 (89)
T TIGR03829         1 KCRWCEEEKAIARTTTVYWELPDGTKAIEIKETPSISCSHCGMEYQDDTT   50 (89)
T ss_pred             CCcccCCCceecceEEEEEEecCCceEEEEecCCcccccCCCcEeecHHH
Confidence            48888541      3345555555          3689999998754443


No 196
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=56.27  E-value=6.5  Score=24.73  Aligned_cols=28  Identities=21%  Similarity=0.700  Sum_probs=15.4

Q ss_pred             CCCCC--CCCCCceeEeCCCCc--eEeCCCcccc
Q 030241            4 AFCSD--CKKHTEVVFDHSAGD--TVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~--Cg~~~~iv~D~~~G~--~vC~~CG~Vl   33 (181)
                      ..||.  |+.  .+..+.....  +.|..||...
T Consensus        19 ~~Cp~~~C~~--~~~~~~~~~~~~~~C~~C~~~f   50 (64)
T PF01485_consen   19 RWCPNPDCEY--IIEKDDGCNSPIVTCPSCGTEF   50 (64)
T ss_dssp             C--TTSST-----ECS-SSTTS--CCTTSCCSEE
T ss_pred             cCCCCCCCcc--cEEecCCCCCCeeECCCCCCcC
Confidence            57977  986  3555555555  8899998764


No 197
>PF13790 DUF4182:  Domain of unknown function (DUF4182)
Probab=56.15  E-value=5.8  Score=23.58  Aligned_cols=13  Identities=31%  Similarity=0.925  Sum_probs=11.6

Q ss_pred             CceEeCCCccccc
Q 030241           22 GDTVCSECGLVLE   34 (181)
Q Consensus        22 G~~vC~~CG~Vl~   34 (181)
                      |.+||..|+.+|+
T Consensus         2 GtIvCq~C~~~Id   14 (38)
T PF13790_consen    2 GTIVCQHCNETID   14 (38)
T ss_pred             CEEEeccccceee
Confidence            7899999999984


No 198
>KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7.0 [Transcription]
Probab=55.93  E-value=6.4  Score=25.71  Aligned_cols=25  Identities=36%  Similarity=0.987  Sum_probs=14.5

Q ss_pred             CCCCCCCCCceeEeCCCCc-eEeCCCcccc
Q 030241            5 FCSDCKKHTEVVFDHSAGD-TVCSECGLVL   33 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~-~vC~~CG~Vl   33 (181)
                      .|-+||. .+.+   ..|+ +-|.+||.=|
T Consensus        22 iCgdC~~-en~l---k~~D~irCReCG~RI   47 (62)
T KOG3507|consen   22 ICGDCGQ-ENTL---KRGDVIRCRECGYRI   47 (62)
T ss_pred             Eeccccc-cccc---cCCCcEehhhcchHH
Confidence            4788886 3322   2344 4588888643


No 199
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=55.64  E-value=3.8  Score=39.84  Aligned_cols=11  Identities=45%  Similarity=1.226  Sum_probs=0.0

Q ss_pred             eEeCCCccccc
Q 030241           24 TVCSECGLVLE   34 (181)
Q Consensus        24 ~vC~~CG~Vl~   34 (181)
                      ..|..||..++
T Consensus       681 ~~Cp~C~~~~~  691 (900)
T PF03833_consen  681 YVCPDCGIEVE  691 (900)
T ss_dssp             -----------
T ss_pred             eeccccccccC
Confidence            45666666554


No 200
>PRK00222 methionine sulfoxide reductase B; Provisional
Probab=54.70  E-value=11  Score=28.92  Aligned_cols=34  Identities=26%  Similarity=0.500  Sum_probs=27.4

Q ss_pred             EeCCCCceEeCCCccccc--cCCccccccccccccC
Q 030241           17 FDHSAGDTVCSECGLVLE--SHSIDETSEWRTFANE   50 (181)
Q Consensus        17 ~D~~~G~~vC~~CG~Vl~--e~~id~~~Ewr~F~~~   50 (181)
                      ...+.|.++|..||.-|=  +.-+|+|.-|.+|.+.
T Consensus        37 ~~~~~G~Y~C~~Cg~pLF~S~~Kf~Sg~GWPSF~~~   72 (142)
T PRK00222         37 DNKEKGIYVCIVCGEPLFSSDTKFDSGCGWPSFTKP   72 (142)
T ss_pred             CCCCCeEEEecCCCchhcCCcccccCCCCCcCcCcc
Confidence            345899999999999884  4457889999999854


No 201
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=54.66  E-value=6.4  Score=26.78  Aligned_cols=11  Identities=45%  Similarity=1.141  Sum_probs=4.3

Q ss_pred             CCCCCCCCCCC
Q 030241            1 MTDAFCSDCKK   11 (181)
Q Consensus         1 m~~~~Cp~Cg~   11 (181)
                      |....||.||.
T Consensus        22 ~~k~FCp~CGn   32 (73)
T PF08772_consen   22 MTKQFCPKCGN   32 (73)
T ss_dssp             SS--S-SSS--
T ss_pred             CCceeCcccCC
Confidence            55677888886


No 202
>PF01807 zf-CHC2:  CHC2 zinc finger;  InterPro: IPR002694 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents CycHisCysCys (CHC2) type zinc finger domains, which are found in bacteria and viruses. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0003896 DNA primase activity, 0008270 zinc ion binding, 0006260 DNA replication; PDB: 1D0Q_B 2AU3_A.
Probab=54.60  E-value=12  Score=26.48  Aligned_cols=27  Identities=15%  Similarity=0.389  Sum_probs=17.2

Q ss_pred             CCCCCCCC-CceeEeCCCCceEeCCCcc
Q 030241            5 FCSDCKKH-TEVVFDHSAGDTVCSECGL   31 (181)
Q Consensus         5 ~Cp~Cg~~-~~iv~D~~~G~~vC~~CG~   31 (181)
                      .||.|+.. +++.++...|...|-.||.
T Consensus        35 ~CPfH~d~~pS~~i~~~k~~~~Cf~Cg~   62 (97)
T PF01807_consen   35 LCPFHDDKTPSFSINPDKNRFKCFGCGK   62 (97)
T ss_dssp             --SSS--SS--EEEETTTTEEEETTT--
T ss_pred             ECcCCCCCCCceEEECCCCeEEECCCCC
Confidence            49999853 4688899999999999984


No 203
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=54.53  E-value=5.5  Score=29.34  Aligned_cols=19  Identities=16%  Similarity=0.324  Sum_probs=11.4

Q ss_pred             ceeEeCCCCceEeCCCccc
Q 030241           14 EVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus        14 ~iv~D~~~G~~vC~~CG~V   32 (181)
                      .+..+...+...|.+||..
T Consensus        62 ~L~Ie~vp~~~~C~~Cg~~   80 (117)
T PRK00564         62 ILDIVDEKVELECKDCSHV   80 (117)
T ss_pred             EEEEEecCCEEEhhhCCCc
Confidence            4555556666666666633


No 204
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=54.52  E-value=7.7  Score=39.43  Aligned_cols=6  Identities=33%  Similarity=1.088  Sum_probs=2.8

Q ss_pred             CCCCCC
Q 030241            5 FCSDCK   10 (181)
Q Consensus         5 ~Cp~Cg   10 (181)
                      +||+||
T Consensus       669 kCPkCG  674 (1337)
T PRK14714        669 RCPSCG  674 (1337)
T ss_pred             ECCCCC
Confidence            344444


No 205
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=54.48  E-value=11  Score=22.80  Aligned_cols=23  Identities=35%  Similarity=0.528  Sum_probs=17.3

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCcccccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVLES   35 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e   35 (181)
                      +|..|+.. +       ...+|..||.|.-.
T Consensus         1 ~C~~C~~~-~-------~l~~CL~C~~~~c~   23 (50)
T smart00290        1 RCSVCGTI-E-------NLWLCLTCGQVGCG   23 (50)
T ss_pred             CcccCCCc-C-------CeEEecCCCCcccC
Confidence            58899962 2       26799999999753


No 206
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=54.19  E-value=11  Score=36.40  Aligned_cols=27  Identities=26%  Similarity=0.742  Sum_probs=23.0

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      ..||+|..  .+++...+|.+.|--||..
T Consensus       445 ~~Cp~Cd~--~lt~H~~~~~L~CH~Cg~~  471 (730)
T COG1198         445 AECPNCDS--PLTLHKATGQLRCHYCGYQ  471 (730)
T ss_pred             ccCCCCCc--ceEEecCCCeeEeCCCCCC
Confidence            46899975  5788889999999999998


No 207
>PRK06260 threonine synthase; Validated
Probab=54.07  E-value=5.6  Score=35.16  Aligned_cols=30  Identities=37%  Similarity=0.625  Sum_probs=22.2

Q ss_pred             CCCCCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            1 MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         1 m~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      |-..+|+.||. .   ++...-...|..||-.|+
T Consensus         1 ~~~~~C~~cg~-~---~~~~~~~~~Cp~cg~~l~   30 (397)
T PRK06260          1 MYWLKCIECGK-E---YDPDEIIYTCPECGGLLE   30 (397)
T ss_pred             CCEEEECCCCC-C---CCCCCccccCCCCCCeEE
Confidence            55678999997 2   344455678999998764


No 208
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=54.04  E-value=5  Score=29.30  Aligned_cols=30  Identities=23%  Similarity=0.473  Sum_probs=19.4

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      ..|-+||+..+.-.+..-|-.+|..|.-|-
T Consensus        14 ~~CaDCg~~~p~w~s~~~GiflC~~Cag~H   43 (116)
T PF01412_consen   14 KVCADCGAPNPTWASLNYGIFLCLECAGIH   43 (116)
T ss_dssp             TB-TTT-SBS--EEETTTTEEE-HHHHHHH
T ss_pred             CcCCCCCCCCCCEEEeecChhhhHHHHHHH
Confidence            569999985455566678999999998774


No 209
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=53.38  E-value=9.3  Score=31.09  Aligned_cols=27  Identities=37%  Similarity=0.855  Sum_probs=21.6

Q ss_pred             CCCCCCCCCCc-eeEeCCCCceEeCCCc
Q 030241            4 AFCSDCKKHTE-VVFDHSAGDTVCSECG   30 (181)
Q Consensus         4 ~~Cp~Cg~~~~-iv~D~~~G~~vC~~CG   30 (181)
                      ..|-.||+..+ ..++..+|-.+|..|+
T Consensus       150 ~~C~~Cg~~~~~~~f~~~~gg~~c~~c~  177 (247)
T PRK00085        150 DHCAVCGAPGDHRYFSPKEGGAVCSECG  177 (247)
T ss_pred             hhHhcCCCCCCceEEecccCCccccccc
Confidence            36999997422 5678899999999997


No 210
>cd07973 Spt4 Transcription elongation factor Spt4. Spt4 is a transcription elongation factor. Three transcription-elongation factors Spt4, Spt5, and Spt6, are conserved among eukaryotes and are essential for transcription via the modulation of chromatin structure. It is known that Spt4, Spt5, and Spt6 are general transcription-elongation factors, controlling transcription both positively and negatively in important regulatory and developmental roles.   Spt4 functions entirely in the context of the Spt4-Spt5 heterodimer and it has been found only as a complex to Spt5 in Yeast and Human. Spt4 is a small protein that has zinc finger at the N-terminus.   Spt5 is a large protein that has several interesting structural features of an acidic N-terminus, a single NGN domain, five or six KOW domains, and a set of simple C-termianl repeats. Spt4 binds to Spt5 NGN domain. Unlike Spt5, Spt4 is not essential for viability in yeast, however Spt4 is critical for normal function of the Spt4-Spt5 compl
Probab=53.24  E-value=9  Score=27.55  Aligned_cols=27  Identities=19%  Similarity=0.369  Sum_probs=17.5

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      ..|..|+-   |..+..--...|.+||.++
T Consensus         4 rAC~~C~~---I~~~~qf~~~gCpnC~~~l   30 (98)
T cd07973           4 RACLLCSL---IKTEDQFERDGCPNCEGYL   30 (98)
T ss_pred             chhccCCc---ccccccccCCCCCCCcchh
Confidence            56888885   3333333457899998766


No 211
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=53.06  E-value=12  Score=23.46  Aligned_cols=28  Identities=21%  Similarity=0.867  Sum_probs=19.7

Q ss_pred             CCCC--CCCCCCceeEe--CCCCceEeCCCcccc
Q 030241            4 AFCS--DCKKHTEVVFD--HSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp--~Cg~~~~iv~D--~~~G~~vC~~CG~Vl   33 (181)
                      ..||  .|+.  .+..+  .....+.|..||...
T Consensus        19 ~~CP~~~C~~--~~~~~~~~~~~~v~C~~C~~~f   50 (64)
T smart00647       19 KWCPAPDCSA--AIIVTEEEGCNRVTCPKCGFSF   50 (64)
T ss_pred             cCCCCCCCcc--eEEecCCCCCCeeECCCCCCeE
Confidence            5699  8986  33343  367788999898764


No 212
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=52.75  E-value=2.8  Score=27.38  Aligned_cols=27  Identities=22%  Similarity=0.557  Sum_probs=19.1

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeC-CCcccccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCS-ECGLVLES   35 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~-~CG~Vl~e   35 (181)
                      ...||.||.  +|.-    .+..|+ +|+.....
T Consensus         3 HkHC~~CG~--~Ip~----~~~fCS~~C~~~~~k   30 (59)
T PF09889_consen    3 HKHCPVCGK--PIPP----DESFCSPKCREEYRK   30 (59)
T ss_pred             CCcCCcCCC--cCCc----chhhhCHHHHHHHHH
Confidence            467999996  3422    489995 89887643


No 213
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=52.44  E-value=9.5  Score=25.77  Aligned_cols=26  Identities=23%  Similarity=0.676  Sum_probs=15.7

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      ..||.|..  ++  +...|.+.|..|+.-+
T Consensus         2 ~~CP~C~~--~L--~~~~~~~~C~~C~~~~   27 (70)
T PF07191_consen    2 NTCPKCQQ--EL--EWQGGHYHCEACQKDY   27 (70)
T ss_dssp             -B-SSS-S--BE--EEETTEEEETTT--EE
T ss_pred             CcCCCCCC--cc--EEeCCEEECccccccc
Confidence            46999996  44  4456899999998754


No 214
>KOG0656 consensus G1/S-specific cyclin D [Cell cycle control, cell division, chromosome partitioning]
Probab=52.42  E-value=58  Score=28.54  Aligned_cols=55  Identities=16%  Similarity=0.146  Sum_probs=38.9

Q ss_pred             HHHHHHHHHHHHHhCCchHHHHH--HHHHHHH-hh-h---C---HHHHHHHHHHHHHHhCCC--Ccc
Q 030241          106 ILAFKTIATMSDRIGQMRYIRRW--KIKSLVE-AE-I---K---THYWLLACTLLVDKKTSH--ALL  160 (181)
Q Consensus       106 ~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~-~~-l---~---~~~v~AAclYiACR~~~~--p~t  160 (181)
                      .+|+..|=+.|+..+....+.=-  .++-... -. +   +   ..-+++|||.+|.+.+..  |++
T Consensus        79 ~~A~~WIl~V~~~~~~~~~~~~LA~NYlDRFls~~~l~k~k~W~lQLlAvaCLsLAsKmeE~~vPll  145 (335)
T KOG0656|consen   79 KQALDWILKVCEEYNFEPLVFLLAMNYLDRFLSSQKLPKDKPWMLQLLAVACLSLASKMEETDVPLL  145 (335)
T ss_pred             HHHHHHHHHHHHHhCCchHHHHHHHHHHHHhhcccccCCCchHHHHHHHHHHHHHHHhhcCcCCchh
Confidence            45889999999988887654333  3333321 11 3   4   789999999999999876  765


No 215
>PRK06386 replication factor A; Reviewed
Probab=52.08  E-value=6.9  Score=34.52  Aligned_cols=21  Identities=33%  Similarity=0.642  Sum_probs=15.1

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      .+||+|+.   .+.+     -.|.+||.|
T Consensus       237 ~rCP~C~R---~l~~-----g~C~~HG~v  257 (358)
T PRK06386        237 TKCSVCNK---IIED-----GVCKDHPDA  257 (358)
T ss_pred             ecCcCCCe---EccC-----CcCCCCCCC
Confidence            47999986   2232     399999975


No 216
>PRK14526 adenylate kinase; Provisional
Probab=52.06  E-value=10  Score=30.62  Aligned_cols=33  Identities=15%  Similarity=0.354  Sum_probs=22.8

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      ..||.||...++.+++.....+|..||--+.-+
T Consensus       123 ~~~~~~g~~y~~~~~pp~~~~~~~~~~~~l~~R  155 (211)
T PRK14526        123 RICKSCNNIFNIYTLPTKEKGICDVCKGDLYQR  155 (211)
T ss_pred             CcccccCCccccccCCCCccCcCCCCCCeeecc
Confidence            458888876566777766677888887655433


No 217
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=51.76  E-value=5.4  Score=23.10  Aligned_cols=27  Identities=33%  Similarity=0.778  Sum_probs=13.2

Q ss_pred             CCCCCCC-CceeEeCCCCce-EeCCCccc
Q 030241            6 CSDCKKH-TEVVFDHSAGDT-VCSECGLV   32 (181)
Q Consensus         6 Cp~Cg~~-~~iv~D~~~G~~-vC~~CG~V   32 (181)
                      |-+|+.. +..-.....|.. +|..||+-
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~~   29 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGLY   29 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHHH
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHHH
Confidence            5677752 222333346666 78888764


No 218
>TIGR00613 reco DNA repair protein RecO. All proteins in this family for which functions are known are DNA binding proteins that are involved in the initiation of recombination or recombinational repair.
Probab=51.74  E-value=11  Score=30.61  Aligned_cols=28  Identities=25%  Similarity=0.705  Sum_probs=20.9

Q ss_pred             CCCCCCCCCC-ceeEeCCCCceEeCCCcc
Q 030241            4 AFCSDCKKHT-EVVFDHSAGDTVCSECGL   31 (181)
Q Consensus         4 ~~Cp~Cg~~~-~iv~D~~~G~~vC~~CG~   31 (181)
                      ..|..||... ...++...|-.+|.+|+.
T Consensus       148 ~~C~~cg~~~~~~~fs~~~gg~~C~~c~~  176 (241)
T TIGR00613       148 DKCAVCGSKEDLIYFSMTYGGALCRQCGE  176 (241)
T ss_pred             CccCCCCCcCCCceEchhcCeEEChhhCc
Confidence            4688898621 256778899999999965


No 219
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=51.63  E-value=6.1  Score=23.66  Aligned_cols=16  Identities=38%  Similarity=0.931  Sum_probs=12.8

Q ss_pred             CceEeCCCccccccCC
Q 030241           22 GDTVCSECGLVLESHS   37 (181)
Q Consensus        22 G~~vC~~CG~Vl~e~~   37 (181)
                      |.+.|..||++.....
T Consensus        12 ~~~~C~~CgM~Y~~~~   27 (41)
T PF13878_consen   12 GATTCPTCGMLYSPGS   27 (41)
T ss_pred             CCcCCCCCCCEECCCC
Confidence            6789999999985443


No 220
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed
Probab=51.31  E-value=12  Score=34.52  Aligned_cols=33  Identities=33%  Similarity=0.608  Sum_probs=21.9

Q ss_pred             CCCCCCCCCcee---EeCCCC--ceEeCCCccccccCCc
Q 030241            5 FCSDCKKHTEVV---FDHSAG--DTVCSECGLVLESHSI   38 (181)
Q Consensus         5 ~Cp~Cg~~~~iv---~D~~~G--~~vC~~CG~Vl~e~~i   38 (181)
                      .||+||.....+   +|.+.|  .+.| +||.--+-.+-
T Consensus       177 ic~~cg~~~~~~~~~~d~~~~~v~y~~-~cG~~~~~~~~  214 (510)
T PRK00750        177 ICPKCGKVLTTPVISYDAEAGTVTYDC-ECGHEGEVPVT  214 (510)
T ss_pred             eCCCCCccceEEEEEEeCCCCEEEEEc-CCCCEEEEecC
Confidence            699999854433   476776  4556 49988655443


No 221
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=51.28  E-value=11  Score=30.35  Aligned_cols=30  Identities=27%  Similarity=0.619  Sum_probs=17.1

Q ss_pred             CCCCCCCCCc---eeEe--CCCC-----ceEeCCCccccc
Q 030241            5 FCSDCKKHTE---VVFD--HSAG-----DTVCSECGLVLE   34 (181)
Q Consensus         5 ~Cp~Cg~~~~---iv~D--~~~G-----~~vC~~CG~Vl~   34 (181)
                      .||+||....   ..++  +--|     ...|.+||+=-.
T Consensus         2 ~Cp~C~~~~~~~~~~~~~IP~F~evii~sf~C~~CGyr~~   41 (192)
T TIGR00310         2 DCPSCGGECETVMKTVNDIPYFGEVLETSTICEHCGYRSN   41 (192)
T ss_pred             cCCCCCCCCEEEEEEEcCCCCcceEEEEEEECCCCCCccc
Confidence            5999986321   1122  1123     346999998643


No 222
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=50.25  E-value=11  Score=25.26  Aligned_cols=26  Identities=31%  Similarity=0.687  Sum_probs=19.7

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      +| .||.  -++.|...-.--| .||..+.
T Consensus         5 rC-~Cgr--~lya~e~~kTkkC-~CG~~l~   30 (68)
T PF09082_consen    5 RC-DCGR--YLYAKEGAKTKKC-VCGKTLK   30 (68)
T ss_dssp             EE-TTS----EEEETT-SEEEE-TTTEEEE
T ss_pred             Ee-cCCC--EEEecCCcceeEe-cCCCeee
Confidence            58 7997  4788888888999 9999974


No 223
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=50.21  E-value=9.6  Score=32.21  Aligned_cols=29  Identities=28%  Similarity=0.594  Sum_probs=12.1

Q ss_pred             CCCCCCCCCCc-eeEeCCC--C--ceEeCCCccc
Q 030241            4 AFCSDCKKHTE-VVFDHSA--G--DTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~-iv~D~~~--G--~~vC~~CG~V   32 (181)
                      ..||.||+.+. -+.....  |  .+.|.-||.-
T Consensus       173 g~CPvCGs~P~~s~l~~~~~~G~R~L~Cs~C~t~  206 (290)
T PF04216_consen  173 GYCPVCGSPPVLSVLRGGEREGKRYLHCSLCGTE  206 (290)
T ss_dssp             SS-TTT---EEEEEEE------EEEEEETTT--E
T ss_pred             CcCCCCCCcCceEEEecCCCCccEEEEcCCCCCe
Confidence            57999998422 1222222  3  5889999864


No 224
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=49.41  E-value=8.6  Score=27.91  Aligned_cols=31  Identities=23%  Similarity=0.405  Sum_probs=22.2

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ..|-+||+..+--....-|-.+|.+|.-|-.
T Consensus         4 ~~CaDC~~~~p~w~s~~~GifvC~~CsgiHR   34 (112)
T smart00105        4 KKCFDCGAPNPTWASVNLGVFLCIECSGIHR   34 (112)
T ss_pred             CcccCCCCCCCCcEEeccceeEhHHhHHHHH
Confidence            4688999743334455679999999988853


No 225
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=49.26  E-value=11  Score=32.06  Aligned_cols=30  Identities=27%  Similarity=0.523  Sum_probs=19.8

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ...|+.||.++.  .-...=..+|.+||...=
T Consensus       111 ~RFCg~CG~~~~--~~~~g~~~~C~~cg~~~f  140 (279)
T COG2816         111 HRFCGRCGTKTY--PREGGWARVCPKCGHEHF  140 (279)
T ss_pred             CcCCCCCCCcCc--cccCceeeeCCCCCCccC
Confidence            468999998432  122233578999998763


No 226
>COG5333 CCL1 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]
Probab=49.18  E-value=46  Score=28.65  Aligned_cols=62  Identities=13%  Similarity=0.164  Sum_probs=40.5

Q ss_pred             CCchHHHHHHHHHHHHHHHHhCCchHH--HH-----H---H---HHHHH----Hhh------h--CHHHHHHHHHHHHHH
Q 030241           99 SNPDRGLILAFKTIATMSDRIGQMRYI--RR-----W---K---IKSLV----EAE------I--KTHYWLLACTLLVDK  153 (181)
Q Consensus        99 ~~~er~l~~a~~~I~~ia~~L~Lp~~v--~e-----~---~---i~k~a----~~~------l--~~~~v~AAclYiACR  153 (181)
                      +++++-+.--+..++.++.-|.++...  .+     -   .   .+..+    .|.      +  +...+++||+++||+
T Consensus       125 ~sr~~Il~~E~~lLEaL~fd~~V~hPy~~l~~f~~~~q~~~~~~~~~~aw~~inDa~~t~~~llypphiIA~a~l~ia~~  204 (297)
T COG5333         125 SSRERILEYEFELLEALDFDLHVHHPYKYLEGFLKDLQEKDKYKLLQIAWKIINDALRTDLCLLYPPHIIALAALLIACE  204 (297)
T ss_pred             ccHHHHHHHHHHHHHHcccceEeccccHHHHHHHHHHHhccHHHHHHHHHHHHHhhhhceeeeecChHHHHHHHHHHHHH
Confidence            466777777788888887777664321  11     1   1   11111    111      1  889999999999999


Q ss_pred             hCCCCcc
Q 030241          154 KTSHALL  160 (181)
Q Consensus       154 ~~~~p~t  160 (181)
                      ..+.|+-
T Consensus       205 ~~~~~~~  211 (297)
T COG5333         205 VLGMPII  211 (297)
T ss_pred             hcCCccc
Confidence            9998864


No 227
>PRK08197 threonine synthase; Validated
Probab=47.61  E-value=8.2  Score=34.06  Aligned_cols=27  Identities=33%  Similarity=0.746  Sum_probs=19.4

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ..+|+.||. .   ++.+.-...| .||-.++
T Consensus         7 ~~~C~~Cg~-~---~~~~~~~~~C-~cg~~l~   33 (394)
T PRK08197          7 HLECSKCGE-T---YDADQVHNLC-KCGKPLL   33 (394)
T ss_pred             EEEECCCCC-C---CCCCCcceec-CCCCeeE
Confidence            367999997 2   3444556889 8997764


No 228
>TIGR00357 methionine-R-sulfoxide reductase. This model describes a domain found in PilB, a protein important for pilin expression, N-terminal to a domain coextensive to with the known peptide methionine sulfoxide reductase (MsrA), a protein repair enzyme, of E. coli. Among the early completed genomes, this module is found if and only if MsrA is also found, whether N-terminal to MsrA (as for Helicobacter pylori), C-terminal (as for Treponema pallidum), or in a separate polypeptide. Although the function of this region is not clear, an auxiliary function to MsrA is suggested.
Probab=47.11  E-value=14  Score=28.04  Aligned_cols=33  Identities=24%  Similarity=0.410  Sum_probs=27.0

Q ss_pred             eCCCCceEeCCCccccc--cCCccccccccccccC
Q 030241           18 DHSAGDTVCSECGLVLE--SHSIDETSEWRTFANE   50 (181)
Q Consensus        18 D~~~G~~vC~~CG~Vl~--e~~id~~~Ewr~F~~~   50 (181)
                      ..+.|.++|..||.-|=  +.-+|+|.-|.+|.+.
T Consensus        35 ~~~~G~Y~C~~Cg~pLF~S~~KfdSg~GWPSF~~~   69 (134)
T TIGR00357        35 NKEEGIYVDITCGEPLFSSEDKFDSGCGWPSFYKP   69 (134)
T ss_pred             CCCCeEEEccCCCCccccccchhcCCCCCcCcCcc
Confidence            45899999999999875  4457889999999754


No 229
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=45.85  E-value=12  Score=24.65  Aligned_cols=20  Identities=30%  Similarity=0.672  Sum_probs=15.4

Q ss_pred             eeEeC-CCCceEeCCCccccc
Q 030241           15 VVFDH-SAGDTVCSECGLVLE   34 (181)
Q Consensus        15 iv~D~-~~G~~vC~~CG~Vl~   34 (181)
                      +..|. ++|+.+|.-||.+..
T Consensus        39 V~L~mg~~gev~CPYC~t~y~   59 (62)
T COG4391          39 VFLDMGDEGEVVCPYCSTRYR   59 (62)
T ss_pred             EEEEcCCCCcEecCccccEEE
Confidence            44443 899999999999863


No 230
>COG4643 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=45.23  E-value=13  Score=32.64  Aligned_cols=26  Identities=31%  Similarity=0.717  Sum_probs=21.8

Q ss_pred             CCCCCCCCCceeEeCC--CCceEeCCCc
Q 030241            5 FCSDCKKHTEVVFDHS--AGDTVCSECG   30 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~--~G~~vC~~CG   30 (181)
                      -||.||...-+-+|..  +|..+|--||
T Consensus        34 ~cpvcg~k~RFr~dD~kGrGtw~c~y~~   61 (366)
T COG4643          34 PCPVCGGKDRFRFDDRKGRGTWFCNYCG   61 (366)
T ss_pred             CCCccCCccccccCCccCCccEEEEeec
Confidence            6999998666777763  6999999999


No 231
>PF10005 DUF2248:  Uncharacterized protein conserved in bacteria (DUF2248);  InterPro: IPR011201 This is a family of uncharacterised bacterial proteins.
Probab=45.07  E-value=13  Score=32.63  Aligned_cols=25  Identities=36%  Similarity=0.862  Sum_probs=19.2

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCcccccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVLES   35 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e   35 (181)
                      .|+.||.  .+.|+    ...|..||.-|+=
T Consensus         1 ~C~~Cg~--~v~Fe----Nt~C~~Cg~~LGf   25 (343)
T PF10005_consen    1 SCPNCGQ--PVFFE----NTRCLSCGSALGF   25 (343)
T ss_pred             CCCCCCC--cceeC----CCccccCCccccC
Confidence            4999996  35553    5899999998863


No 232
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=44.99  E-value=18  Score=28.28  Aligned_cols=29  Identities=28%  Similarity=0.665  Sum_probs=16.6

Q ss_pred             CCCCCCCCcee----Ee-CCCCc-----eEeCCCccccc
Q 030241            6 CSDCKKHTEVV----FD-HSAGD-----TVCSECGLVLE   34 (181)
Q Consensus         6 Cp~Cg~~~~iv----~D-~~~G~-----~vC~~CG~Vl~   34 (181)
                      ||.||..+...    ++ +--|+     ..|.+||+=-.
T Consensus         1 CP~Cg~~~~~~~~~~~~IP~F~evii~sf~C~~CGyr~~   39 (163)
T TIGR00340         1 CPVCGSRTLKAVTYDYDIPYFGKIMLSTYICEKCGYRST   39 (163)
T ss_pred             CCCCCCcceEeeeEeccCCCcceEEEEEEECCCCCCchh
Confidence            99999631111    11 12333     46999998754


No 233
>PRK01110 rpmF 50S ribosomal protein L32; Validated
Probab=44.32  E-value=12  Score=24.37  Aligned_cols=28  Identities=7%  Similarity=0.007  Sum_probs=17.6

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCCcc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSID   39 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id   39 (181)
                      ..||+||..  . .    ---||. ||+--+..+++
T Consensus        28 ~~c~~cg~~--~-~----pH~vc~-cG~Y~gr~v~~   55 (60)
T PRK01110         28 SVDKTTGEY--H-L----PHHVSP-KGYYKGRKVLK   55 (60)
T ss_pred             eEcCCCCce--e-c----cceecC-CcccCCeEeec
Confidence            458888862  1 1    236788 99776655554


No 234
>cd00674 LysRS_core_class_I catalytic core domain of  class I lysyl tRNA synthetase. Class I lysyl tRNA synthetase (LysRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity.
Probab=44.26  E-value=18  Score=31.87  Aligned_cols=33  Identities=36%  Similarity=0.768  Sum_probs=20.3

Q ss_pred             CCCCCCCCCCcee--EeCCCC--ceEeCCCccccccCC
Q 030241            4 AFCSDCKKHTEVV--FDHSAG--DTVCSECGLVLESHS   37 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv--~D~~~G--~~vC~~CG~Vl~e~~   37 (181)
                      -.||+||..+..+  +|.+.|  .+.| +||.--+-.+
T Consensus       170 p~c~~cg~~~~~v~~~d~~~~~v~y~c-~cG~~g~~~~  206 (353)
T cd00674         170 PYCEKCGKDTTTVEAYDAKAGTVTYKC-ECGHEETVDI  206 (353)
T ss_pred             eecCCcCcceeEEEEEeCCCCeEEEEc-CCCCEEEEee
Confidence            3699999633333  444444  5678 5998765444


No 235
>PHA03074 late transcription factor VLTF-3; Provisional
Probab=43.92  E-value=15  Score=30.02  Aligned_cols=30  Identities=23%  Similarity=0.569  Sum_probs=24.7

Q ss_pred             CCCCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            2 TDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         2 ~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ....|..|++ ..+|.+  .|-..|-.|+.|..
T Consensus         3 ~l~~C~~C~~-ngiv~~--k~~efC~fC~~~f~   32 (225)
T PHA03074          3 NLKLCSGCRH-NGIVSE--KDYEFCIFCESVFQ   32 (225)
T ss_pred             chhhcCCCCC-CCeeee--cCEEEeecHHHHHh
Confidence            4467999997 677664  89999999999975


No 236
>PF09334 tRNA-synt_1g:  tRNA synthetases class I (M);  InterPro: IPR015413 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This domain is found in methionyl and leucyl tRNA synthetases. ; GO: 0000166 nucleotide binding, 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0006418 tRNA aminoacylation for protein translation, 0005737 cytoplasm; PDB: 2D5B_A 1A8H_A 1WOY_A 2D54_A 4DLP_A 2CT8_B 2CSX_A 1MED_A 1PFU_A 1PFW_A ....
Probab=43.78  E-value=11  Score=33.32  Aligned_cols=24  Identities=38%  Similarity=0.876  Sum_probs=14.3

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ..||.||.      +...| ..|.+||..++
T Consensus       137 g~CP~C~~------~~a~g-~~Ce~cG~~~~  160 (391)
T PF09334_consen  137 GTCPYCGS------DKARG-DQCENCGRPLE  160 (391)
T ss_dssp             CEETTT--------SSCTT-TEETTTSSBEE
T ss_pred             ccccCcCc------cccCC-CcccCCCCCcc
Confidence            35888874      22334 56788888876


No 237
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=43.59  E-value=14  Score=33.24  Aligned_cols=32  Identities=19%  Similarity=0.430  Sum_probs=24.0

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccccccCCcc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSID   39 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id   39 (181)
                      .||.||.. .  ....++..-|..||+-..+..+.
T Consensus       352 ~Cp~Cg~~-m--~S~G~~g~rC~kCg~~~~~~~~~  383 (421)
T COG1571         352 VCPRCGGR-M--KSAGRNGFRCKKCGTRARETLIK  383 (421)
T ss_pred             CCCccCCc-h--hhcCCCCcccccccccCCccccc
Confidence            69999973 2  34445579999999998776654


No 238
>PF14369 zf-RING_3:  zinc-finger
Probab=42.12  E-value=17  Score=21.01  Aligned_cols=26  Identities=23%  Similarity=0.640  Sum_probs=15.5

Q ss_pred             CCCCCCCCCCceeEe-CCCCceEeCCCcc
Q 030241            4 AFCSDCKKHTEVVFD-HSAGDTVCSECGL   31 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D-~~~G~~vC~~CG~   31 (181)
                      .+|-.|..  .+... ..+.++.|..|+-
T Consensus         3 ywCh~C~~--~V~~~~~~~~~~~CP~C~~   29 (35)
T PF14369_consen    3 YWCHQCNR--FVRIAPSPDSDVACPRCHG   29 (35)
T ss_pred             EeCccCCC--EeEeCcCCCCCcCCcCCCC
Confidence            46888986  23332 2344445999973


No 239
>PRK06450 threonine synthase; Validated
Probab=41.24  E-value=12  Score=32.38  Aligned_cols=29  Identities=28%  Similarity=0.620  Sum_probs=20.4

Q ss_pred             CCCCCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            1 MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         1 m~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      |...+|+.||. .   ++. .-...|.+||-.|+
T Consensus         1 ~~~~~C~~Cg~-~---~~~-~~~~~C~~cg~~l~   29 (338)
T PRK06450          1 MVKEVCMKCGK-E---RES-IYEIRCKKCGGPFE   29 (338)
T ss_pred             CceeEECCcCC-c---CCC-cccccCCcCCCEeE
Confidence            45678999997 3   232 33578999997765


No 240
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=41.02  E-value=15  Score=23.97  Aligned_cols=22  Identities=27%  Similarity=0.505  Sum_probs=13.0

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      .+||+||.-|--.        .|..||-+.
T Consensus         6 rkC~~cg~YTLke--------~Cp~CG~~t   27 (59)
T COG2260           6 RKCPKCGRYTLKE--------KCPVCGGDT   27 (59)
T ss_pred             hcCcCCCceeecc--------cCCCCCCcc
Confidence            5678887532112        277788765


No 241
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=40.77  E-value=19  Score=23.35  Aligned_cols=30  Identities=30%  Similarity=0.551  Sum_probs=15.6

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHS   37 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~   37 (181)
                      ..|..|+..    |..-...--|..||.|+=..-
T Consensus        10 ~~C~~C~~~----F~~~~rrhhCr~CG~~vC~~C   39 (69)
T PF01363_consen   10 SNCMICGKK----FSLFRRRHHCRNCGRVVCSSC   39 (69)
T ss_dssp             SB-TTT--B-----BSSS-EEE-TTT--EEECCC
T ss_pred             CcCcCcCCc----CCCceeeEccCCCCCEECCch
Confidence            569999862    455677888999998875443


No 242
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=40.62  E-value=13  Score=37.78  Aligned_cols=8  Identities=50%  Similarity=1.244  Sum_probs=5.1

Q ss_pred             CCCCCCCC
Q 030241            5 FCSDCKKH   12 (181)
Q Consensus         5 ~Cp~Cg~~   12 (181)
                      +||+||++
T Consensus       681 fCP~CGs~  688 (1337)
T PRK14714        681 RCPDCGTH  688 (1337)
T ss_pred             cCcccCCc
Confidence            57777763


No 243
>PF14319 Zn_Tnp_IS91:  Transposase zinc-binding domain
Probab=40.60  E-value=8.9  Score=27.97  Aligned_cols=34  Identities=21%  Similarity=0.566  Sum_probs=24.3

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCCcc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSID   39 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id   39 (181)
                      ..|++||. ..++...=.+- .|..||..-.+..++
T Consensus        43 ~~C~~Cg~-~~~~~~SCk~R-~CP~C~~~~~~~W~~   76 (111)
T PF14319_consen   43 YRCEDCGH-EKIVYNSCKNR-HCPSCQAKATEQWIE   76 (111)
T ss_pred             eecCCCCc-eEEecCcccCc-CCCCCCChHHHHHHH
Confidence            46999996 56666554444 999999997655543


No 244
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=40.28  E-value=15  Score=22.74  Aligned_cols=14  Identities=29%  Similarity=0.707  Sum_probs=11.9

Q ss_pred             CCceEeCCCccccc
Q 030241           21 AGDTVCSECGLVLE   34 (181)
Q Consensus        21 ~G~~vC~~CG~Vl~   34 (181)
                      +|.++|..||.-+-
T Consensus         3 ~g~l~C~~CG~~m~   16 (58)
T PF13408_consen    3 SGLLRCGHCGSKMT   16 (58)
T ss_pred             CCcEEcccCCcEeE
Confidence            58899999998764


No 245
>TIGR02642 phage_xxxx uncharacterized phage protein. This uncharacterized protein is found in prophage regions of Shewanella oneidensis MR-1, Vibrio vulnificus YJ016, Yersinia pseudotuberculosis IP 32953, and Aeromonas hydrophila ATCC7966. It appears to have regions of sequence similarity to phage lambda antitermination protein Q.
Probab=40.00  E-value=18  Score=29.05  Aligned_cols=23  Identities=17%  Similarity=0.548  Sum_probs=14.5

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECG   30 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG   30 (181)
                      ..||.|+....++.    +...|.+|+
T Consensus       100 ~~C~~C~G~G~~i~----~~~~C~~C~  122 (186)
T TIGR02642       100 CKCPRCRGTGLIQR----RQRECDTCA  122 (186)
T ss_pred             CcCCCCCCeeEEec----CCCCCCCCC
Confidence            57999987333322    125688885


No 246
>PF14149 YhfH:  YhfH-like protein
Probab=39.72  E-value=5.3  Score=23.61  Aligned_cols=16  Identities=31%  Similarity=0.696  Sum_probs=12.5

Q ss_pred             CCceEeCCCccccccC
Q 030241           21 AGDTVCSECGLVLESH   36 (181)
Q Consensus        21 ~G~~vC~~CG~Vl~e~   36 (181)
                      -+.-.|++||..++|.
T Consensus        11 Lp~K~C~~CG~~i~EQ   26 (37)
T PF14149_consen   11 LPPKKCTECGKEIEEQ   26 (37)
T ss_pred             CCCcccHHHHHHHHHH
Confidence            4567899999998764


No 247
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=39.69  E-value=23  Score=22.23  Aligned_cols=8  Identities=25%  Similarity=0.866  Sum_probs=6.7

Q ss_pred             CCCCCCCC
Q 030241            4 AFCSDCKK   11 (181)
Q Consensus         4 ~~Cp~Cg~   11 (181)
                      ..||.||+
T Consensus        14 ~~Cp~CGN   21 (49)
T PF12677_consen   14 CKCPKCGN   21 (49)
T ss_pred             ccCcccCC
Confidence            46999997


No 248
>PRK08329 threonine synthase; Validated
Probab=39.51  E-value=19  Score=31.17  Aligned_cols=25  Identities=24%  Similarity=0.701  Sum_probs=17.2

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .+|+.||..    ++.... ..| .||-.|+
T Consensus         2 l~C~~Cg~~----~~~~~~-~~C-~c~~~l~   26 (347)
T PRK08329          2 LRCTKCGRT----YEEKFK-LRC-DCGGTLL   26 (347)
T ss_pred             cCcCCCCCC----cCCCCc-eec-CCCCcEE
Confidence            689999972    233333 789 8997764


No 249
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=39.31  E-value=20  Score=21.31  Aligned_cols=8  Identities=25%  Similarity=0.829  Sum_probs=5.4

Q ss_pred             CCCCCCCC
Q 030241            4 AFCSDCKK   11 (181)
Q Consensus         4 ~~Cp~Cg~   11 (181)
                      ..||.||+
T Consensus         3 ~~Cp~Cg~   10 (47)
T PF14690_consen    3 PRCPHCGS   10 (47)
T ss_pred             ccCCCcCC
Confidence            46777775


No 250
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=39.10  E-value=12  Score=22.27  Aligned_cols=26  Identities=27%  Similarity=0.658  Sum_probs=13.2

Q ss_pred             CCCCCCCCCC---ceeEeCCCCceEeCCC
Q 030241            4 AFCSDCKKHT---EVVFDHSAGDTVCSEC   29 (181)
Q Consensus         4 ~~Cp~Cg~~~---~iv~D~~~G~~vC~~C   29 (181)
                      .+|..||++.   ..++.-..|-.||.+|
T Consensus         2 ~~CSFCgr~~~~v~~li~g~~~~~IC~~C   30 (41)
T PF06689_consen    2 KRCSFCGRPESEVGRLISGPNGAYICDEC   30 (41)
T ss_dssp             -B-TTT--BTTTSSSEEEES-SEEEEHHH
T ss_pred             CCccCCCCCHHHHhceecCCCCcEECHHH
Confidence            4799999742   1233334478899887


No 251
>PF14951 DUF4503:  Domain of unknown function (DUF4503)
Probab=38.98  E-value=21  Score=31.60  Aligned_cols=38  Identities=21%  Similarity=0.468  Sum_probs=29.2

Q ss_pred             CCCCCCCCCceeEeC-CCCceEeCCCccccccCCcccccc
Q 030241            5 FCSDCKKHTEVVFDH-SAGDTVCSECGLVLESHSIDETSE   43 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~-~~G~~vC~~CG~Vl~e~~id~~~E   43 (181)
                      .|..||+ ..++..+ ++|..-|.+|-.|+.+..+--.-|
T Consensus       276 vCd~CGn-~rLe~~pe~rg~~~C~~Cs~~V~sP~~r~~Le  314 (389)
T PF14951_consen  276 VCDRCGN-GRLEQSPEDRGAFSCGDCSRVVTSPVLRMHLE  314 (389)
T ss_pred             cccccCC-ccceeCccCCCceeccchhhhccCcceeeeEE
Confidence            4999998 7787665 577799999999998766544444


No 252
>KOG0794 consensus CDK8 kinase-activating protein cyclin C [Transcription]
Probab=38.54  E-value=41  Score=28.14  Aligned_cols=22  Identities=18%  Similarity=0.218  Sum_probs=19.8

Q ss_pred             CHHHHHHHHHHHHHHhCCCCcc
Q 030241          139 KTHYWLLACTLLVDKKTSHALL  160 (181)
Q Consensus       139 ~~~~v~AAclYiACR~~~~p~t  160 (181)
                      .+..++.|||||||-..+.+++
T Consensus       192 PPh~IalAcl~Ia~~~~~k~~~  213 (264)
T KOG0794|consen  192 PPHQIALACLYIACVIDEKDIP  213 (264)
T ss_pred             CHHHHHHHHHHHHHhhcCCChH
Confidence            8899999999999999888873


No 253
>PRK00133 metG methionyl-tRNA synthetase; Reviewed
Probab=38.36  E-value=16  Score=34.75  Aligned_cols=22  Identities=36%  Similarity=0.928  Sum_probs=12.6

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      .||.|+. .    | ..|+. |..||..+
T Consensus       141 ~cp~C~~-~----d-~~g~~-ce~cg~~~  162 (673)
T PRK00133        141 TCPKCGA-E----D-QYGDN-CEVCGATY  162 (673)
T ss_pred             ccCCCCC-c----c-cCCch-hhhccccC
Confidence            5888886 2    2 33543 66666544


No 254
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=38.36  E-value=15  Score=28.34  Aligned_cols=15  Identities=40%  Similarity=0.926  Sum_probs=13.1

Q ss_pred             CCCceEeCCCccccc
Q 030241           20 SAGDTVCSECGLVLE   34 (181)
Q Consensus        20 ~~G~~vC~~CG~Vl~   34 (181)
                      .-|.++|.+||..+.
T Consensus       109 g~G~l~C~~Cg~~~~  123 (146)
T PF07295_consen  109 GPGTLVCENCGHEVE  123 (146)
T ss_pred             cCceEecccCCCEEE
Confidence            579999999999874


No 255
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=38.20  E-value=20  Score=29.06  Aligned_cols=36  Identities=28%  Similarity=0.398  Sum_probs=22.3

Q ss_pred             CCCCCCCCCCceeE----e-CCCC-----ceEeCCCccccccCCccc
Q 030241            4 AFCSDCKKHTEVVF----D-HSAG-----DTVCSECGLVLESHSIDE   40 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~----D-~~~G-----~~vC~~CG~Vl~e~~id~   40 (181)
                      ..||.||+ +-...    | +--|     .++|..||+=..|-...+
T Consensus        15 ~~CPvCg~-~l~~~~~~~~IPyFG~V~i~t~~C~~CgYR~~DV~~~e   60 (201)
T COG1779          15 IDCPVCGG-TLKAHMYLYDIPYFGEVLISTGVCERCGYRSTDVKTLE   60 (201)
T ss_pred             ecCCcccc-eeeEEEeeecCCccceEEEEEEEccccCCcccceeecc
Confidence            56999997 21111    1 1233     368999999876665544


No 256
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=37.85  E-value=18  Score=33.75  Aligned_cols=25  Identities=32%  Similarity=0.909  Sum_probs=13.9

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      .||.||.      +...|+ -|.+||..++..
T Consensus       144 ~cp~cg~------~~arGD-~Ce~Cg~~~~P~  168 (558)
T COG0143         144 TCPKCGG------EDARGD-QCENCGRTLDPT  168 (558)
T ss_pred             cCCCcCc------cccCcc-hhhhccCcCCch
Confidence            4777774      112333 466777776543


No 257
>COG2126 RPL37A Ribosomal protein L37E [Translation, ribosomal structure and biogenesis]
Probab=37.72  E-value=18  Score=23.59  Aligned_cols=25  Identities=20%  Similarity=0.603  Sum_probs=16.7

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      ..|..||. ...  .  --.-.|+.||.=-
T Consensus        17 ~~CRRCGr-~sy--h--v~k~~CaaCGfgr   41 (61)
T COG2126          17 IRCRRCGR-RSY--H--VRKKYCAACGFGR   41 (61)
T ss_pred             ehhhhccc-hhe--e--eccceecccCCCC
Confidence            56999997 332  2  2356899999763


No 258
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
Probab=37.52  E-value=28  Score=27.11  Aligned_cols=29  Identities=17%  Similarity=0.422  Sum_probs=16.5

Q ss_pred             CCCCCCCCCc---eeEe-CCCCc-----eEeCCCcccc
Q 030241            5 FCSDCKKHTE---VVFD-HSAGD-----TVCSECGLVL   33 (181)
Q Consensus         5 ~Cp~Cg~~~~---iv~D-~~~G~-----~vC~~CG~Vl   33 (181)
                      .||.||....   ..++ +--|+     ..|.+||+=-
T Consensus         2 ~Cp~C~~~~~~~~~~~~IP~F~evii~sf~C~~CGyk~   39 (160)
T smart00709        2 DCPSCGGNGTTRMLLTSIPYFREVIIMSFECEHCGYRN   39 (160)
T ss_pred             cCCCCCCCCEEEEEEecCCCcceEEEEEEECCCCCCcc
Confidence            5999985321   1111 12333     4699999864


No 259
>PF01907 Ribosomal_L37e:  Ribosomal protein L37e;  InterPro: IPR001569 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families consists of proteins of 56 to 96 amino-acid residues that share a highly conserved region located in the N-terminal part.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A19_A 4A1D_A 4A18_A 4A1B_A 1S1I_Y 3O5H_d 3IZS_l 3O58_d 2ZKR_2 3IZR_l ....
Probab=37.50  E-value=23  Score=22.79  Aligned_cols=24  Identities=21%  Similarity=0.834  Sum_probs=15.0

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      ..|..||+ ..  +.  --.-.|..||+=
T Consensus        16 ~~CrRCG~-~s--yH--~qK~~CasCGyp   39 (55)
T PF01907_consen   16 TLCRRCGR-RS--YH--IQKKTCASCGYP   39 (55)
T ss_dssp             EE-TTTSS-EE--EE--TTTTEETTTBTT
T ss_pred             eeecccCC-ee--ee--cCCCcccccCCC
Confidence            45888987 22  22  235789999875


No 260
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=37.36  E-value=24  Score=26.47  Aligned_cols=30  Identities=27%  Similarity=0.546  Sum_probs=19.4

Q ss_pred             CCCCCCCCCCCceeEeC----CCCceEeCCCcccc
Q 030241            3 DAFCSDCKKHTEVVFDH----SAGDTVCSECGLVL   33 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~----~~G~~vC~~CG~Vl   33 (181)
                      +..||.|++ ..++.--    ..--..|.+||.-.
T Consensus        30 ~~~cP~C~s-~~~~k~g~~~~~~qRyrC~~C~~tf   63 (129)
T COG3677          30 KVNCPRCKS-SNVVKIGGIRRGHQRYKCKSCGSTF   63 (129)
T ss_pred             cCcCCCCCc-cceeeECCccccccccccCCcCcce
Confidence            468999998 4533221    12357899999765


No 261
>PLN02569 threonine synthase
Probab=37.18  E-value=19  Score=33.03  Aligned_cols=27  Identities=11%  Similarity=0.054  Sum_probs=20.6

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ...|+.||. .   ++.+.-...| .||-.|+
T Consensus        49 ~l~C~~Cg~-~---y~~~~~~~~C-~cgg~l~   75 (484)
T PLN02569         49 FLECPLTGE-K---YSLDEVVYRS-KSGGLLD   75 (484)
T ss_pred             ccEeCCCCC-c---CCCccccccC-CCCCeEE
Confidence            467999997 2   4556667899 8998885


No 262
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=37.16  E-value=33  Score=20.15  Aligned_cols=29  Identities=24%  Similarity=0.408  Sum_probs=16.9

Q ss_pred             CCCCCCCCCCceeEeCCCC-ceEeCC---Ccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAG-DTVCSE---CGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G-~~vC~~---CG~Vl   33 (181)
                      ..||.||+ .-++.....| .+.|++   |....
T Consensus         2 ~~CP~Cg~-~lv~r~~k~g~F~~Cs~yP~C~~~~   34 (39)
T PF01396_consen    2 EKCPKCGG-PLVLRRGKKGKFLGCSNYPECKYTE   34 (39)
T ss_pred             cCCCCCCc-eeEEEECCCCCEEECCCCCCcCCeE
Confidence            57999996 3333333443 446765   66554


No 263
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=37.07  E-value=29  Score=22.32  Aligned_cols=27  Identities=22%  Similarity=0.476  Sum_probs=14.4

Q ss_pred             CCCCCCCCCce--eEeC--CCCceEeCCCcc
Q 030241            5 FCSDCKKHTEV--VFDH--SAGDTVCSECGL   31 (181)
Q Consensus         5 ~Cp~Cg~~~~i--v~D~--~~G~~vC~~CG~   31 (181)
                      .||.||+.+.+  -.|.  .+=-+.|..|-.
T Consensus         6 ~CP~CgnKTR~kir~DT~LkNfPlyCpKCK~   36 (55)
T PF14205_consen    6 LCPICGNKTRLKIREDTVLKNFPLYCPKCKQ   36 (55)
T ss_pred             ECCCCCCccceeeecCceeccccccCCCCCc
Confidence            58888864322  2221  233467877753


No 264
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF01641 SelR:  SelR domain;  InterPro: IPR002579 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine []. It is present in most living organisms, and the cognate structural gene belongs to the so-called minimum gene set [, ]. The domains: MsrA and MsrB, reduce different epimeric forms of methionine sulphoxide. This group represents MsrB, the crystal structure of which has been determined to 1.8A []. The overall structure shows no resemblance to the structures of MsrA (IPR002569 from INTERPRO) from other organisms; though the active sites show approximate mirror symmetry. In each case, conserved amino acid motifs mediate the stereo-specific recognition and reduction of the substrate. Unlike the MsrA domain, the MsrB domain activates the cysteine or selenocysteine nucleophile through a unique Cys-Arg-Asp/Glu catalytic triad. The collapse of the reaction intermediate most likely results in the formation of a sulphenic or selenenic acid moiety. Regeneration of the active site occurs through a series of thiol-disulphide exchange steps involving another active site Cys residue and thioredoxin. In a number of pathogenic bacteria, including Neisseria gonorrhoeae, the MsrA and MsrB domains are fused; the MsrA being N-terminal to MsrB. This arrangement is reversed in Treponema pallidum. In N. gonorrhoeae and Neisseria meningitidis, a thioredoxin domain is fused to the N terminus. This may function to reduce the active sites of the downstream MsrA and MsrB domains. ; GO: 0008113 peptide-methionine-(S)-S-oxide reductase activity, 0055114 oxidation-reduction process; PDB: 1L1D_A 3E0O_D 2KZN_A 3HCG_B 3HCH_A 2L1U_A 3MAO_A 2K8D_A 3HCJ_A 3HCI_A ....
Probab=36.91  E-value=19  Score=26.96  Aligned_cols=33  Identities=27%  Similarity=0.547  Sum_probs=25.2

Q ss_pred             eCCCCceEeCCCccccc--cCCccccccccccccC
Q 030241           18 DHSAGDTVCSECGLVLE--SHSIDETSEWRTFANE   50 (181)
Q Consensus        18 D~~~G~~vC~~CG~Vl~--e~~id~~~Ewr~F~~~   50 (181)
                      ..+.|.++|..||.-|=  +.-+|++.-|.+|.+.
T Consensus        32 ~~~~G~Y~C~~Cg~pLF~S~~Kf~Sg~GWPSF~~~   66 (124)
T PF01641_consen   32 HKEEGIYVCAVCGTPLFSSDTKFDSGCGWPSFWQP   66 (124)
T ss_dssp             TTSSEEEEETTTS-EEEEGGGEETSSSSSSEESSC
T ss_pred             CCCCEEEEcCCCCCccccCcccccCCcCCccccCc
Confidence            34789999999999884  3345888899999754


No 266
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=36.71  E-value=15  Score=28.54  Aligned_cols=30  Identities=20%  Similarity=0.589  Sum_probs=14.1

Q ss_pred             CCCCCCCCCCce---eEe-CCCCce-----EeCCCcccc
Q 030241            4 AFCSDCKKHTEV---VFD-HSAGDT-----VCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~i---v~D-~~~G~~-----vC~~CG~Vl   33 (181)
                      ..||.||.....   .+| +--|++     .|.+||+=-
T Consensus         2 s~Cp~C~~~~~~~~~~~~IP~F~evii~sf~C~~CGyk~   40 (161)
T PF03367_consen    2 SLCPNCGENGTTRILLTDIPYFKEVIIMSFECEHCGYKN   40 (161)
T ss_dssp             EE-TTTSSCCEEEEEEEEETTTEEEEEEEEE-TTT--EE
T ss_pred             CcCCCCCCCcEEEEEEEcCCCCceEEEEEeECCCCCCEe
Confidence            469999974221   111 233433     799999854


No 267
>COG0229 Conserved domain frequently associated with peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones]
Probab=36.44  E-value=27  Score=26.68  Aligned_cols=33  Identities=27%  Similarity=0.564  Sum_probs=26.6

Q ss_pred             eCCCCceEeCCCccccc--cCCccccccccccccC
Q 030241           18 DHSAGDTVCSECGLVLE--SHSIDETSEWRTFANE   50 (181)
Q Consensus        18 D~~~G~~vC~~CG~Vl~--e~~id~~~Ewr~F~~~   50 (181)
                      ..+.|-++|..||.-|=  +.-.|+|--|.+|.+-
T Consensus        37 ~~~~GiY~c~~cg~pLF~S~~KfdSgcGWPSF~~p   71 (140)
T COG0229          37 NKEKGIYVCIVCGEPLFSSEDKFDSGCGWPSFTKP   71 (140)
T ss_pred             ccCCceEEeecCCCccccccccccCCCCCcccccc
Confidence            34899999999998774  4457889999999754


No 268
>PF08421 Methyltransf_13:  Putative zinc binding domain;  InterPro: IPR013630 This domain is found at the N terminus of bacterial methyltransferases. ; PDB: 4E2X_A 3NDJ_A 3NDI_A 4E32_A 4E33_A 4E31_A 4E2Y_A 4E2W_A 4E2Z_A 4E30_A.
Probab=36.25  E-value=20  Score=23.21  Aligned_cols=17  Identities=35%  Similarity=0.687  Sum_probs=9.9

Q ss_pred             ceEeCCCccccccCCcc
Q 030241           23 DTVCSECGLVLESHSID   39 (181)
Q Consensus        23 ~~vC~~CG~Vl~e~~id   39 (181)
                      -.+|.+||+|.=+..++
T Consensus        40 l~~C~~CglvQl~~~v~   56 (62)
T PF08421_consen   40 LYVCEDCGLVQLEEVVP   56 (62)
T ss_dssp             EEEETTT--EEESS---
T ss_pred             EEECCCCCchhcCCcCC
Confidence            36899999998777665


No 269
>PF02236 Viral_DNA_bi:  Viral DNA-binding protein, all alpha domain;  InterPro: IPR003176 This domain represents the N-terminal domain of the viral DNA-binding protein, a multi functional protein involved in DNA replication and transcription control.; GO: 0003677 DNA binding, 0006260 DNA replication, 0006351 transcription, DNA-dependent, 0042025 host cell nucleus; PDB: 1ADU_A 1ADV_B 2WB0_X 2WAZ_X 1ANV_A.
Probab=36.09  E-value=49  Score=23.17  Aligned_cols=59  Identities=14%  Similarity=0.043  Sum_probs=34.1

Q ss_pred             HHHHHHHHHHHHHHhCCchH-H---HHH-HHHHHHHhhhCHHHHHHHHHHHHHHhCCCCcc-ccChhhheecccce
Q 030241          105 LILAFKTIATMSDRIGQMRY-I---RRW-KIKSLVEAEIKTHYWLLACTLLVDKKTSHALL-RVQPKILLTSGCFL  174 (181)
Q Consensus       105 l~~a~~~I~~ia~~L~Lp~~-v---~e~-~i~k~a~~~l~~~~v~AAclYiACR~~~~p~t-~~~~~~~~~~~~~~  174 (181)
                      -++|+..+..+++.+++-.. +   =|. ++|+++...           |+-=+....++| +-||....+-|+||
T Consensus         6 wQkaMe~~~~l~e~~kvd~~~~t~lPd~~e~~~Ki~~~-----------~l~~~k~~~~LTFSS~KSf~~~mGRfL   70 (86)
T PF02236_consen    6 WQKAMELAHKLMEKYKVDWKGFTFLPDQGECFRKICQT-----------WLNEEKRGLQLTFSSQKSFTHMMGRFL   70 (86)
T ss_dssp             HHHHHHHHHHHHHHTT--HHH--S-TT--HHHHHHHHH-----------HHHHHHTT---SS--HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHhccccccCeECCCcHHHHHHHHHH-----------HHHhcCcCCCcceechHHHHHHHHHHH
Confidence            35688999999999988655 1   122 577776554           444445566677 66777777777776


No 270
>PRK04179 rpl37e 50S ribosomal protein L37e; Reviewed
Probab=35.83  E-value=19  Score=23.76  Aligned_cols=24  Identities=21%  Similarity=0.733  Sum_probs=15.6

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCcc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGL   31 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~   31 (181)
                      ...|..||+ ...  .  --...|..||+
T Consensus        17 Ht~CrRCG~-~sy--h--~qK~~CasCGy   40 (62)
T PRK04179         17 HIRCRRCGR-HSY--N--VRKKYCAACGF   40 (62)
T ss_pred             cchhcccCc-ccc--c--ccccchhhcCC
Confidence            356888887 332  2  23578889987


No 271
>PRK00118 putative DNA-binding protein; Validated
Probab=35.68  E-value=1.2e+02  Score=21.92  Aligned_cols=40  Identities=10%  Similarity=0.082  Sum_probs=24.0

Q ss_pred             HHHHHHHHhCCchHHHHH------HHHHHHHhh--h-----CHHHHHHHHHHH
Q 030241          111 TIATMSDRIGQMRYIRRW------KIKSLVEAE--I-----KTHYWLLACTLL  150 (181)
Q Consensus       111 ~I~~ia~~L~Lp~~v~e~------~i~k~a~~~--l-----~~~~v~AAclYi  150 (181)
                      .+.+||..+|+|...+..      .-.++++++  |     ..+.++|+..|+
T Consensus        35 S~~EIAe~lGIS~~TV~r~L~RArkkLr~~~~~~~~~~~~~~~~~~~~~~~~~   87 (104)
T PRK00118         35 SLGEIAEEFNVSRQAVYDNIKRTEKLLEDYEEKLHLYEKFIERNELFDKIAYL   87 (104)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHHHHHHHHHHHHHChHHHHHHHHHHHHHHHHH
Confidence            467788888888765544      233444444  2     456666666554


No 272
>COG5134 Uncharacterized conserved protein [Function unknown]
Probab=35.34  E-value=32  Score=28.39  Aligned_cols=25  Identities=20%  Similarity=0.304  Sum_probs=17.9

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSE   28 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~   28 (181)
                      .+||.|+..-.+-+|+.+|++|=..
T Consensus        80 I~C~~C~n~i~~RTDPkN~~YV~Es  104 (272)
T COG5134          80 IKCHLCSNPIDVRTDPKNTEYVVES  104 (272)
T ss_pred             EEccCCCCceeeecCCCCceEEEec
Confidence            4588888755677788888877554


No 273
>PRK07591 threonine synthase; Validated
Probab=35.08  E-value=16  Score=32.70  Aligned_cols=26  Identities=31%  Similarity=0.574  Sum_probs=18.8

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .+|+.||..    ++...- ..|.+||-.|+
T Consensus        19 l~C~~Cg~~----~~~~~~-~~C~~cg~~l~   44 (421)
T PRK07591         19 LKCRECGAE----YPLGPI-HVCEECFGPLE   44 (421)
T ss_pred             EEeCCCCCc----CCCCCC-ccCCCCCCeEE
Confidence            579999972    333333 88999998775


No 274
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=34.64  E-value=24  Score=30.49  Aligned_cols=29  Identities=28%  Similarity=0.519  Sum_probs=17.0

Q ss_pred             CCCCCCCCCCC--ceeEe-CCCC--ceEeCCCcc
Q 030241            3 DAFCSDCKKHT--EVVFD-HSAG--DTVCSECGL   31 (181)
Q Consensus         3 ~~~Cp~Cg~~~--~iv~D-~~~G--~~vC~~CG~   31 (181)
                      ...||.||+.+  .++.. ...|  .+.|.-||.
T Consensus       187 ~~~CPvCGs~P~~s~v~~~~~~G~RyL~CslC~t  220 (309)
T PRK03564        187 RQFCPVCGSMPVSSVVQIGTTQGLRYLHCNLCES  220 (309)
T ss_pred             CCCCCCCCCcchhheeeccCCCCceEEEcCCCCC
Confidence            36799999843  22211 1233  567777764


No 275
>PHA00689 hypothetical protein
Probab=34.18  E-value=28  Score=21.98  Aligned_cols=27  Identities=22%  Similarity=0.516  Sum_probs=17.5

Q ss_pred             CCCceEeCCCccccccCCcccccccccc
Q 030241           20 SAGDTVCSECGLVLESHSIDETSEWRTF   47 (181)
Q Consensus        20 ~~G~~vC~~CG~Vl~e~~id~~~Ewr~F   47 (181)
                      +--.+.|..||.- +-+.-|+|-||.-.
T Consensus        14 epravtckrcgkt-glrweddggewvlm   40 (62)
T PHA00689         14 EPRAVTCKRCGKT-GLRWEDDGGEWVLM   40 (62)
T ss_pred             Ccceeehhhcccc-CceeecCCCcEEEE
Confidence            4445678888865 44566777788643


No 276
>PRK00448 polC DNA polymerase III PolC; Validated
Probab=33.97  E-value=22  Score=36.91  Aligned_cols=31  Identities=39%  Similarity=0.813  Sum_probs=23.3

Q ss_pred             CCCCCCCCCCCceeEeCCCC------ceEeCCCccccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAG------DTVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G------~~vC~~CG~Vl~   34 (181)
                      ...||+|+- .+++.|.+-|      +-.|..||.-+.
T Consensus       908 hy~C~~C~~-~ef~~~~~~~sG~Dlpdk~Cp~Cg~~~~  944 (1437)
T PRK00448        908 HYVCPNCKY-SEFFTDGSVGSGFDLPDKDCPKCGTKLK  944 (1437)
T ss_pred             cccCccccc-ccccccccccccccCccccCcccccccc
Confidence            467999995 7877775444      467999999875


No 277
>PRK05638 threonine synthase; Validated
Probab=33.86  E-value=22  Score=31.87  Aligned_cols=25  Identities=28%  Similarity=0.735  Sum_probs=17.2

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .+|+.||. .   ++.. -...| +||-.++
T Consensus         2 l~C~~Cg~-~---~~~~-~~~~C-~c~~~l~   26 (442)
T PRK05638          2 MKCPKCGR-E---YNSY-IPPFC-ICGELLE   26 (442)
T ss_pred             eEeCCCCC-C---CCCC-Cceec-CCCCcEE
Confidence            57999997 2   2322 23889 8997775


No 278
>PRK04023 DNA polymerase II large subunit; Validated
Probab=33.72  E-value=26  Score=35.10  Aligned_cols=8  Identities=38%  Similarity=0.920  Sum_probs=4.8

Q ss_pred             CCCCCCCC
Q 030241            4 AFCSDCKK   11 (181)
Q Consensus         4 ~~Cp~Cg~   11 (181)
                      .+||.||.
T Consensus       627 RfCpsCG~  634 (1121)
T PRK04023        627 RKCPSCGK  634 (1121)
T ss_pred             ccCCCCCC
Confidence            45666664


No 279
>PF05460 ORC6:  Origin recognition complex subunit 6 (ORC6);  InterPro: IPR008721  The Origin Recognition Complex (ORC) is a six-subunit ATP-dependent DNA-binding complex encoded in yeast by ORC1-6 []. ORC is a central component for eukaryotic DNA replication, and binds chromatin at replication origins throughout the cell cycle []. ORC directs DNA replication throughout the genome and is required for its initiation [, , ]. ORC bound at replication origins serves as the foundation for assembly of the pre-replicative complex (pre-RC), which includes Cdc6, Tah11 (aka Cdt1), and the Mcm2-7 complex [, , ]. Pre-RC assembly during G1 is required for replication licensing of chromosomes prior to DNA synthesis during S phase [, , ]. Cell cycle-regulated phosphorylation of Orc2, Orc6, Cdc6, and MCM by the cyclin-dependent protein kinase Cdc28 regulates initiation of DNA replication, including blocking reinitiation in G2/M phase [, , , ].   In yeast, ORC also plays a role in the establishment of silencing at the mating-type loci Hidden MAT Left (HML) and Hidden MAT Right (HMR) [, , ]. ORC participates in the assembly of transcriptionally silent chromatin at HML and HMR by recruiting the Sir1 silencing protein to the HML and HMR silencers [, , ].   Both Orc1 and Orc5 bind ATP, though only Orc1 has ATPase activity []. The binding of ATP by Orc1 is required for ORC binding to DNA and is essential for cell viability []. The ATPase activity of Orc1 is involved in formation of the pre-RC [, , ]. ATP binding by Orc5 is crucial for the stability of ORC as a whole. Only the Orc1-5 subunits are required for origin binding; Orc6 is essential for maintenance of pre-RCs once formed []. Interactions within ORC suggest that Orc2-3-6 may form a core complex [].   ORC homologues have been found in various eukaryotes, including fission yeast, insects, amphibians, and humans [].   This entry represents subunit 6, which directs DNA replication by binding to replication origins and is also involved in transcriptional silencing; interacts with Spp1 and with trimethylated histone H3; phosphorylated by Cdc28 [, ].   In Saccharomyces cerevisiae (Baker's yeast), both ends of the Orc6 interact with Cdt1 [] and the N terminus mediates an interaction with the S-phase cyclin Clb5 []. ; GO: 0003677 DNA binding, 0006260 DNA replication, 0005664 nuclear origin of replication recognition complex; PDB: 3M03_B.
Probab=33.70  E-value=14  Score=32.47  Aligned_cols=46  Identities=11%  Similarity=0.146  Sum_probs=0.0

Q ss_pred             HHHHHhCC--chHHHHH--HHHHHHHhh---h---CHHHHHHHHHHHHHHhCCCCc
Q 030241          114 TMSDRIGQ--MRYIRRW--KIKSLVEAE---I---KTHYWLLACTLLVDKKTSHAL  159 (181)
Q Consensus       114 ~ia~~L~L--p~~v~e~--~i~k~a~~~---l---~~~~v~AAclYiACR~~~~p~  159 (181)
                      +|+..+++  |..++..  ++|++....   +   .--+=+.+|+|+||.+.+.++
T Consensus         3 ~l~p~~~~~~~~~ll~~a~~L~~ls~~~~~~l~~~~EiaR~~iCa~lA~~~l~~~~   58 (353)
T PF05460_consen    3 DLIPKLGGGLPPKLLSKASELYRLSRQKKSSLKPEEEIARAHICAELACERLKEKL   58 (353)
T ss_dssp             --------------------------------------------------------
T ss_pred             hhhhccCCCCCHHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHHHHhCCcc
Confidence            34444544  5667777  788887632   3   223556789999999988776


No 280
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=33.65  E-value=33  Score=21.17  Aligned_cols=30  Identities=27%  Similarity=0.628  Sum_probs=22.0

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHS   37 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~   37 (181)
                      ..|+.|+..    ++.-....-|..||.|+=..-
T Consensus         3 ~~C~~C~~~----F~~~~rk~~Cr~Cg~~~C~~C   32 (57)
T cd00065           3 SSCMGCGKP----FTLTRRRHHCRNCGRIFCSKC   32 (57)
T ss_pred             CcCcccCcc----ccCCccccccCcCcCCcChHH
Confidence            569999862    445677889999999975443


No 281
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=33.50  E-value=36  Score=20.68  Aligned_cols=35  Identities=26%  Similarity=0.601  Sum_probs=22.5

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccccCCccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDE   40 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~   40 (181)
                      +.+|-.|+.  .| .-...--+.|..|++++-++=++.
T Consensus        11 ~~~C~~C~~--~i-~g~~~~g~~C~~C~~~~H~~C~~~   45 (53)
T PF00130_consen   11 PTYCDVCGK--FI-WGLGKQGYRCSWCGLVCHKKCLSK   45 (53)
T ss_dssp             TEB-TTSSS--BE-CSSSSCEEEETTTT-EEETTGGCT
T ss_pred             CCCCcccCc--cc-CCCCCCeEEECCCCChHhhhhhhh
Confidence            467999986  23 223445689999999987665543


No 282
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=33.27  E-value=24  Score=22.17  Aligned_cols=31  Identities=23%  Similarity=0.579  Sum_probs=18.3

Q ss_pred             CCCCCCCCCC--CceeEeC--CCCceEeCCCcccc
Q 030241            3 DAFCSDCKKH--TEVVFDH--SAGDTVCSECGLVL   33 (181)
Q Consensus         3 ~~~Cp~Cg~~--~~iv~D~--~~G~~vC~~CG~Vl   33 (181)
                      ...|..|+-.  +..+.+-  ..+-+.|.+||.+|
T Consensus        22 ~~~C~gC~~~l~~~~~~~i~~~~~i~~Cp~CgRiL   56 (56)
T PF02591_consen   22 GGTCSGCHMELPPQELNEIRKGDEIVFCPNCGRIL   56 (56)
T ss_pred             CCccCCCCEEcCHHHHHHHHcCCCeEECcCCCccC
Confidence            3568888741  1111121  34578999999875


No 283
>TIGR03060 PS_II_psb29 photosystem II biogenesis protein Psp29. Psp29, originally designated sll1414 in Synechocystis 6803, is found universally in Cyanobacteria and in Arabidopsis. It was isolated and partially sequenced from purified photosystem II (PS II) in Synechocystis. While its function is unknown, mutant studies show an impairment in photosystem II biogenesis and/or stability, rather than in PS II core function.
Probab=33.20  E-value=62  Score=26.56  Aligned_cols=29  Identities=7%  Similarity=-0.036  Sum_probs=25.1

Q ss_pred             HHHHHHHHHHhCCchHHHHH--HHHHHHHhh
Q 030241          109 FKTIATMSDRIGQMRYIRRW--KIKSLVEAE  137 (181)
Q Consensus       109 ~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~  137 (181)
                      -+.++++++.||||..-+++  .+|+.-.++
T Consensus       165 ~~~l~~l~~~L~ls~~kv~KDL~lYrsnLeK  195 (214)
T TIGR03060       165 NEILKELSEALGLSYDRVEKDLDLYKSNLEK  195 (214)
T ss_pred             HHHHHHHHHHcCCCHHHHHhhHHHHHhHHHH
Confidence            45889999999999999888  899987665


No 284
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional
Probab=32.98  E-value=86  Score=25.05  Aligned_cols=56  Identities=13%  Similarity=0.137  Sum_probs=32.5

Q ss_pred             CCchHHHHHHH---HHHHHHHHHhCCchHHHHH---HHHHHHHhhhCHHHHHHHHHHHHHHhC
Q 030241           99 SNPDRGLILAF---KTIATMSDRIGQMRYIRRW---KIKSLVEAEIKTHYWLLACTLLVDKKT  155 (181)
Q Consensus        99 ~~~er~l~~a~---~~I~~ia~~L~Lp~~v~e~---~i~k~a~~~l~~~~v~AAclYiACR~~  155 (181)
                      +.+|+.+.+.+   ..-++||++|+++...++.   .+|+|.--+ +...++.-.+-++|+.+
T Consensus       136 T~RE~eVL~ll~~G~snkeIA~~L~iS~~TV~~h~~~I~~KLgv~-n~~eLv~~a~~~~~~~~  197 (207)
T PRK11475        136 SPTEREILRFMSRGYSMPQIAEQLERNIKTIRAHKFNVMSKLGVS-SDAGLLDAADILLCLRH  197 (207)
T ss_pred             CHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHcCCC-CHHHHHHHHHHHHhCcc
Confidence            44565543333   2357899999999987777   677665222 33333333444455544


No 285
>PRK00279 adk adenylate kinase; Reviewed
Probab=32.62  E-value=36  Score=27.04  Aligned_cols=33  Identities=24%  Similarity=0.559  Sum_probs=20.2

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      ..||.||...++.+++......|..||.-+..+
T Consensus       128 ~~~~~~g~~~~~~~~~p~~~~~~~~~~~~l~~r  160 (215)
T PRK00279        128 RICPACGRTYHVKFNPPKVEGKCDVCGEELIQR  160 (215)
T ss_pred             cccCccCCcccccCCCCCCcCcCcCCCCcccCC
Confidence            457777765556666655566677777544433


No 286
>COG5525 Bacteriophage tail assembly protein [General function prediction only]
Probab=32.56  E-value=23  Score=33.31  Aligned_cols=33  Identities=24%  Similarity=0.634  Sum_probs=22.4

Q ss_pred             CCCCCCCCCCceeEeC------------CCCceEeCCCccccccC
Q 030241            4 AFCSDCKKHTEVVFDH------------SAGDTVCSECGLVLESH   36 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~------------~~G~~vC~~CG~Vl~e~   36 (181)
                      .-||+||....+.++.            +.-.+.|..|+.+|.+.
T Consensus       228 vpCPHCGe~q~l~~~e~~~~~g~~~~~~~~~~~~c~h~~~~i~~~  272 (611)
T COG5525         228 VPCPHCGEEQQLKFGEKSGPRGLKDTPAEAAFIQCEHCGCVIRPK  272 (611)
T ss_pred             eeCCCCCchhhccccccCCCcCcccchhhhhhhhccccCceeeee
Confidence            3599999744444422            22346899999999884


No 287
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=32.53  E-value=16  Score=36.32  Aligned_cols=23  Identities=26%  Similarity=0.473  Sum_probs=17.0

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      ..+||.||..        +=...|..||.-.
T Consensus       625 ~RKCPkCG~y--------Tlk~rCP~CG~~T  647 (1095)
T TIGR00354       625 IRKCPQCGKE--------SFWLKCPVCGELT  647 (1095)
T ss_pred             EEECCCCCcc--------cccccCCCCCCcc
Confidence            3689999973        2257899999763


No 288
>smart00400 ZnF_CHCC zinc finger.
Probab=32.46  E-value=60  Score=20.14  Aligned_cols=26  Identities=15%  Similarity=0.310  Sum_probs=20.8

Q ss_pred             CCCCCCCC-CceeEeCCCCceEeCCCc
Q 030241            5 FCSDCKKH-TEVVFDHSAGDTVCSECG   30 (181)
Q Consensus         5 ~Cp~Cg~~-~~iv~D~~~G~~vC~~CG   30 (181)
                      .||-+... +++.++...+..-|-.||
T Consensus         4 ~cPfh~d~~pSf~v~~~kn~~~Cf~cg   30 (55)
T smart00400        4 LCPFHGEKTPSFSVSPDKQFFHCFGCG   30 (55)
T ss_pred             cCcCCCCCCCCEEEECCCCEEEEeCCC
Confidence            59988753 457788888889999997


No 289
>PRK09462 fur ferric uptake regulator; Provisional
Probab=32.01  E-value=23  Score=26.72  Aligned_cols=12  Identities=42%  Similarity=1.113  Sum_probs=10.8

Q ss_pred             ceEeCCCccccc
Q 030241           23 DTVCSECGLVLE   34 (181)
Q Consensus        23 ~~vC~~CG~Vl~   34 (181)
                      -.+|..||.|++
T Consensus        90 H~iC~~Cg~i~~  101 (148)
T PRK09462         90 HLICLDCGKVIE  101 (148)
T ss_pred             ceEECCCCCEEE
Confidence            499999999986


No 290
>PRK13266 Thf1-like protein; Reviewed
Probab=31.88  E-value=66  Score=26.58  Aligned_cols=29  Identities=7%  Similarity=0.023  Sum_probs=25.0

Q ss_pred             HHHHHHHHHHhCCchHHHHH--HHHHHHHhh
Q 030241          109 FKTIATMSDRIGQMRYIRRW--KIKSLVEAE  137 (181)
Q Consensus       109 ~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~  137 (181)
                      .+.++++++.||||..-++.  .+|+.-.++
T Consensus       167 ~~~l~~l~~~L~ls~~kv~KDL~lYrsnLeK  197 (225)
T PRK13266        167 NEALKDISEGLGLSKEKVEKDLDLYRSNLEK  197 (225)
T ss_pred             HHHHHHHHHHcCCCHHHHHhhHHHHHhHHHH
Confidence            35889999999999998888  899987665


No 291
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=31.66  E-value=22  Score=23.49  Aligned_cols=13  Identities=31%  Similarity=0.759  Sum_probs=10.7

Q ss_pred             eEeCCCccccccC
Q 030241           24 TVCSECGLVLESH   36 (181)
Q Consensus        24 ~vC~~CG~Vl~e~   36 (181)
                      +.|..||.|+.+.
T Consensus         5 vRCFTCGkvi~~~   17 (62)
T PRK04016          5 VRCFTCGKVIAEK   17 (62)
T ss_pred             eEecCCCCChHHH
Confidence            6799999999643


No 292
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=31.47  E-value=30  Score=18.24  Aligned_cols=9  Identities=22%  Similarity=0.501  Sum_probs=6.7

Q ss_pred             CCCCCCCCC
Q 030241            3 DAFCSDCKK   11 (181)
Q Consensus         3 ~~~Cp~Cg~   11 (181)
                      ...||.||.
T Consensus         2 l~~C~~CgR   10 (25)
T PF13913_consen    2 LVPCPICGR   10 (25)
T ss_pred             CCcCCCCCC
Confidence            456888886


No 293
>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete. This model represents the lysyl-tRNA synthetases that are class I amino-acyl tRNA synthetases. It includes archaeal and spirochete examples of the enzyme. All other known examples are class IIc amino-acyl tRNA synthetases and seem to form a separate orthologous set.
Probab=31.43  E-value=29  Score=32.08  Aligned_cols=33  Identities=27%  Similarity=0.584  Sum_probs=20.8

Q ss_pred             CCCCCCCCCCceeEeCC---CCceEeCCCccccccCC
Q 030241            4 AFCSDCKKHTEVVFDHS---AGDTVCSECGLVLESHS   37 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~---~G~~vC~~CG~Vl~e~~   37 (181)
                      -.||+||.....+++..   +=.+.| +||.-.+-.+
T Consensus       169 pic~~cGrv~~~~~~~~~~~~v~Y~c-~cG~~g~~~~  204 (515)
T TIGR00467       169 VFCENCGRDTTTVNNYDNEYSIEYSC-ECGNQESVDI  204 (515)
T ss_pred             eecCCcCccCceEEEecCCceEEEEc-CCCCEEEEee
Confidence            36999998543444443   345678 5998865544


No 294
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.41  E-value=40  Score=23.42  Aligned_cols=28  Identities=29%  Similarity=0.609  Sum_probs=18.4

Q ss_pred             CCCCCCCCCCceeEeCCCCc--eEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGD--TVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~--~vC~~CG~Vl   33 (181)
                      ..||.|+-  +++--...|-  --|..|+-|-
T Consensus         2 llCP~C~v--~l~~~~rs~vEiD~CPrCrGVW   31 (88)
T COG3809           2 LLCPICGV--ELVMSVRSGVEIDYCPRCRGVW   31 (88)
T ss_pred             cccCcCCc--eeeeeeecCceeeeCCccccEe
Confidence            56999995  3444333343  3599999885


No 295
>COG4311 SoxD Sarcosine oxidase delta subunit [Amino acid transport and metabolism]
Probab=31.35  E-value=26  Score=25.08  Aligned_cols=12  Identities=25%  Similarity=0.437  Sum_probs=9.4

Q ss_pred             CCCCCCCCCCCC
Q 030241            1 MTDAFCSDCKKH   12 (181)
Q Consensus         1 m~~~~Cp~Cg~~   12 (181)
                      |....||.||..
T Consensus         1 mlLI~CP~Cg~R   12 (97)
T COG4311           1 MLLIPCPYCGER   12 (97)
T ss_pred             CceecCCCCCCC
Confidence            666789999973


No 296
>PRK08173 DNA topoisomerase III; Validated
Probab=31.18  E-value=31  Score=33.98  Aligned_cols=27  Identities=19%  Similarity=0.533  Sum_probs=18.8

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      ..||.||+ . ++.  ..+...|++|+..+-
T Consensus       625 ~~CP~Cg~-~-~~~--~~~~~~Cs~C~f~~~  651 (862)
T PRK08173        625 TPCPNCGG-V-VKE--NYRRFACTKCDFSIS  651 (862)
T ss_pred             ccCCcccc-c-ccc--cCceeEcCCCCcccc
Confidence            46999997 2 322  234499999998773


No 297
>COG1499 NMD3 NMD protein affecting ribosome stability and mRNA decay [Translation, ribosomal structure and biogenesis]
Probab=30.99  E-value=18  Score=31.87  Aligned_cols=12  Identities=17%  Similarity=0.697  Sum_probs=8.9

Q ss_pred             CCCCCCCCCCCC
Q 030241            1 MTDAFCSDCKKH   12 (181)
Q Consensus         1 m~~~~Cp~Cg~~   12 (181)
                      |..+.|+.||..
T Consensus         4 ~~~~~C~~CGr~   15 (355)
T COG1499           4 ASTILCVRCGRS   15 (355)
T ss_pred             CcccEeccCCCc
Confidence            345789999974


No 298
>PRK07956 ligA NAD-dependent DNA ligase LigA; Validated
Probab=30.85  E-value=37  Score=32.46  Aligned_cols=34  Identities=24%  Similarity=0.453  Sum_probs=22.8

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCC---CccccccCCc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSE---CGLVLESHSI   38 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~---CG~Vl~e~~i   38 (181)
                      +..||.||+  .++.+...-.+.|.+   |-.-+..+++
T Consensus       404 P~~CP~Cgs--~l~~~~~~~~~~C~n~~~C~aq~~~~l~  440 (665)
T PRK07956        404 PTHCPVCGS--ELVRVEGEAVLRCTNGLSCPAQLKERLI  440 (665)
T ss_pred             CCCCCCCCC--EeEecCCCeEEECCCCCCCHHHHHHHHH
Confidence            468999997  455554445788973   8666655554


No 299
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=30.72  E-value=27  Score=25.90  Aligned_cols=19  Identities=16%  Similarity=0.580  Sum_probs=10.4

Q ss_pred             eeEeCCCCceEeCCCcccc
Q 030241           15 VVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus        15 iv~D~~~G~~vC~~CG~Vl   33 (181)
                      +......++.-|.+||.++
T Consensus        62 l~Ie~~p~~~~C~~C~~~~   80 (115)
T COG0375          62 LHIEEEPAECWCLDCGQEV   80 (115)
T ss_pred             EEEEEeccEEEeccCCCee
Confidence            4444455666666665544


No 300
>PHA02540 61 DNA primase; Provisional
Probab=30.69  E-value=48  Score=29.05  Aligned_cols=28  Identities=18%  Similarity=0.366  Sum_probs=22.2

Q ss_pred             CCCCCCCC------CceeEeCCCC--ceEeCCCccc
Q 030241            5 FCSDCKKH------TEVVFDHSAG--DTVCSECGLV   32 (181)
Q Consensus         5 ~Cp~Cg~~------~~iv~D~~~G--~~vC~~CG~V   32 (181)
                      .||-|+..      +...+.++.|  ..-|-+||.=
T Consensus        29 ~CPf~~ds~~~~~kpsF~V~p~k~~~~yhCFgCGa~   64 (337)
T PHA02540         29 RCPICGDSQKDKNKARGWIYEKKDGGVFKCHNCGYH   64 (337)
T ss_pred             cCCCCCCccccCcCCcEEEeccCCceEEEecCCCCC
Confidence            59999962      2477888888  8999999963


No 301
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=30.59  E-value=22  Score=26.35  Aligned_cols=18  Identities=22%  Similarity=0.663  Sum_probs=11.1

Q ss_pred             ceeEeCCCCceEeCCCccc
Q 030241           14 EVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus        14 ~iv~D~~~G~~vC~~CG~V   32 (181)
                      .+......+..-| +||..
T Consensus        61 ~L~I~~vp~~~~C-~Cg~~   78 (124)
T PRK00762         61 DLIVEMIPVEIEC-ECGYE   78 (124)
T ss_pred             EEEEEecCeeEEe-eCcCc
Confidence            4555666666677 77743


No 302
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=30.57  E-value=27  Score=20.31  Aligned_cols=10  Identities=40%  Similarity=1.026  Sum_probs=8.1

Q ss_pred             CCCCCCCCCCc
Q 030241            4 AFCSDCKKHTE   14 (181)
Q Consensus         4 ~~Cp~Cg~~~~   14 (181)
                      ..||.|++ +.
T Consensus         6 v~CP~C~s-~~   15 (36)
T PF03811_consen    6 VHCPRCQS-TE   15 (36)
T ss_pred             eeCCCCCC-CC
Confidence            57999998 55


No 303
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators. Ferric uptake regulator (Fur) and related metalloregulatory proteins are iron-dependent, DNA-binding repressors and activators mainly involved in iron metabolism.  A general model for Fur repression under iron-rich conditions is that activated Fur (a dimer having one Fe2+ coordinated per monomer) binds to specific DNA sequences (Fur boxes) in the promoter region of iron-responsive genes, hindering access of RNA polymerase, and repressing transcription. Positive regulation by Fur can be direct or indirect, as in the Fur repression of an anti-sense regulatory small RNA. Some members sense metal ions other than Fe2+.  For example, the zinc uptake regulator (Zur) responds to Zn2+, the manganese uptake regulator (Mur) responds to Mn2+, and the nickel uptake regulator (Nur) responds to Ni2+. Other members sense signals other than metal ions.  
Probab=30.56  E-value=25  Score=24.95  Aligned_cols=13  Identities=31%  Similarity=1.022  Sum_probs=11.4

Q ss_pred             CceEeCCCccccc
Q 030241           22 GDTVCSECGLVLE   34 (181)
Q Consensus        22 G~~vC~~CG~Vl~   34 (181)
                      .-.+|.+||.|.+
T Consensus        72 ~H~~C~~Cg~i~~   84 (116)
T cd07153          72 HHLICTKCGKVID   84 (116)
T ss_pred             CceEeCCCCCEEE
Confidence            3699999999986


No 304
>PF11264 ThylakoidFormat:  Thylakoid formation protein;  InterPro: IPR017499 Psp29, originally designated sll1414 (P73956 from SWISSPROT) in Synechocystis sp. (strain PCC 6803), is found universally in Cyanobacteria and in Arabidopsis. It was isolated and partially sequenced from purified photosystem II (PS II) in Synechocystis. While its function is unknown, mutant studies show an impairment in photosystem II biogenesis and/or stability, rather than in PS II core function.; GO: 0010027 thylakoid membrane organization, 0015979 photosynthesis, 0009523 photosystem II
Probab=30.53  E-value=78  Score=25.99  Aligned_cols=30  Identities=7%  Similarity=0.021  Sum_probs=25.2

Q ss_pred             HHHHHHHHHHHhCCchHHHHH--HHHHHHHhh
Q 030241          108 AFKTIATMSDRIGQMRYIRRW--KIKSLVEAE  137 (181)
Q Consensus       108 a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~  137 (181)
                      --..|+++++.||||..-+++  .+|+...++
T Consensus       161 ~~~~l~~l~~~l~ls~~kv~kDL~lYrsnLeK  192 (216)
T PF11264_consen  161 RPEALEKLSEALGLSKEKVEKDLDLYRSNLEK  192 (216)
T ss_pred             HHHHHHHHHHHcCCCHHHHHhhHHHHHhHHHH
Confidence            345788899999999998888  899987766


No 305
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism]
Probab=30.26  E-value=25  Score=26.70  Aligned_cols=13  Identities=38%  Similarity=0.991  Sum_probs=11.0

Q ss_pred             CceEeCCCccccc
Q 030241           22 GDTVCSECGLVLE   34 (181)
Q Consensus        22 G~~vC~~CG~Vl~   34 (181)
                      .-+||.+||.|++
T Consensus        92 ~HliC~~CG~v~e  104 (145)
T COG0735          92 HHLICLDCGKVIE  104 (145)
T ss_pred             cEEEecCCCCEEE
Confidence            3589999999986


No 306
>TIGR01391 dnaG DNA primase, catalytic core. This protein contains a CHC2 zinc finger (Pfam:PF01807) and a Toprim domain (Pfam:PF01751).
Probab=30.24  E-value=51  Score=29.44  Aligned_cols=34  Identities=15%  Similarity=0.259  Sum_probs=26.0

Q ss_pred             CCCCCCCC-CceeEeCCCCceEeCCCccccccCCccc
Q 030241            5 FCSDCKKH-TEVVFDHSAGDTVCSECGLVLESHSIDE   40 (181)
Q Consensus         5 ~Cp~Cg~~-~~iv~D~~~G~~vC~~CG~Vl~e~~id~   40 (181)
                      .||.|+.. +++.+++..|..-|-.||.  .-++|+.
T Consensus        36 ~CPfh~ek~pSf~v~~~k~~~~Cf~Cg~--~Gd~i~f   70 (415)
T TIGR01391        36 LCPFHHEKTPSFSVSPEKQFYHCFGCGA--GGDAIKF   70 (415)
T ss_pred             eCCCCCCCCCeEEEEcCCCcEEECCCCC--CCCHHHH
Confidence            59999764 4688899999999999996  3345543


No 307
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=29.89  E-value=17  Score=22.75  Aligned_cols=29  Identities=24%  Similarity=0.361  Sum_probs=21.2

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccccCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDE   40 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~   40 (181)
                      ..||-|+.   ++.|     .|...||.|++...|..
T Consensus         2 ~~Cpi~~~---~~~~-----Pv~~~~G~v~~~~~i~~   30 (63)
T smart00504        2 FLCPISLE---VMKD-----PVILPSGQTYERRAIEK   30 (63)
T ss_pred             cCCcCCCC---cCCC-----CEECCCCCEEeHHHHHH
Confidence            46999996   3444     37789999998777753


No 308
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=29.70  E-value=29  Score=22.26  Aligned_cols=36  Identities=28%  Similarity=0.592  Sum_probs=24.8

Q ss_pred             CCCCCCCCC--CceeEeCCCCceEeCC-CccccccCCccc
Q 030241            4 AFCSDCKKH--TEVVFDHSAGDTVCSE-CGLVLESHSIDE   40 (181)
Q Consensus         4 ~~Cp~Cg~~--~~iv~D~~~G~~vC~~-CG~Vl~e~~id~   40 (181)
                      .+|..|+.+  ...+++...| .||.. |-.-++|..+.+
T Consensus         2 ~~CvVCKqpi~~a~~v~T~~G-~VH~g~C~~y~~e~~~SE   40 (54)
T PF10886_consen    2 EICVVCKQPIDDALVVETESG-PVHPGVCAQYLEELPVSE   40 (54)
T ss_pred             CeeeeeCCccCcceEEEcCCC-ccCcHHHHHHHHhccccc
Confidence            579999974  2356666677 67764 877777776543


No 309
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type. The N-terminal region of about 200 amino acids is rich in low-complexity sequence, poorly alignable, and not included n this model.
Probab=29.54  E-value=30  Score=35.42  Aligned_cols=31  Identities=39%  Similarity=0.865  Sum_probs=22.5

Q ss_pred             CCCCCCCCCCCceeEeCCCC------ceEeCCCccccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAG------DTVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G------~~vC~~CG~Vl~   34 (181)
                      ...||+|+- .+++.|..-|      +-.|..||.-+.
T Consensus       683 hy~c~~c~~-~ef~~~~~~~sg~dlp~k~cp~c~~~~~  719 (1213)
T TIGR01405       683 HYLCPNCKY-SEFITDGSVGSGFDLPDKDCPKCGAPLK  719 (1213)
T ss_pred             cccCccccc-ccccccccccccccCccccCcccccccc
Confidence            457999995 6777764333      457999998774


No 310
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=29.39  E-value=35  Score=27.40  Aligned_cols=38  Identities=21%  Similarity=0.373  Sum_probs=23.3

Q ss_pred             CCCCCCCCCCCceeEeC------CCCceEeCCCccccccCCcccc
Q 030241            3 DAFCSDCKKHTEVVFDH------SAGDTVCSECGLVLESHSIDET   41 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~------~~G~~vC~~CG~Vl~e~~id~~   41 (181)
                      ...|..|+.... ..+.      ......|..||-++..+++-.|
T Consensus        95 ~~~C~~C~~~~~-~~~~~~~~~~~~~~p~C~~Cgg~lrP~VV~Fg  138 (206)
T cd01410          95 IEVCKSCGPEYV-RDDVVETRGDKETGRRCHACGGILKDTIVDFG  138 (206)
T ss_pred             cccCCCCCCccc-hHHHHHHhhcCCCCCcCCCCcCccCCcEEECC
Confidence            467999985211 1111      1123569999999888877654


No 311
>PF00488 MutS_V:  MutS domain V C-terminus.;  InterPro: IPR000432 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex. The post-replicative Mismatch Repair System (MMRS) of Escherichia coli involves MutS (Mutator S), MutL and MutH proteins, and acts to correct point mutations or small insertion/deletion loops produced during DNA replication []. MutS and MutL are involved in preventing recombination between partially homologous DNA sequences. The assembly of MMRS is initiated by MutS, which recognises and binds to mispaired nucleotides and allows further action of MutL and MutH to eliminate a portion of newly synthesized DNA strand containing the mispaired base []. MutS can also collaborate with methyltransferases in the repair of O(6)-methylguanine damage, which would otherwise pair with thymine during replication to create an O(6)mG:T mismatch []. MutS exists as a dimer, where the two monomers have different conformations and form a heterodimer at the structural level []. Only one monomer recognises the mismatch specifically and has ADP bound. Non-specific major groove DNA-binding domains from both monomers embrace the DNA in a clamp-like structure. Mismatch binding induces ATP uptake and a conformational change in the MutS protein, resulting in a clamp that translocates on DNA.  MutS is a modular protein with a complex structure [], and is composed of:   N-terminal mismatch-recognition domain, which is similar in structure to tRNA endonuclease. Connector domain, which is similar in structure to Holliday junction resolvase ruvC. Core domain, which is composed of two separate subdomains that join together to form a helical bundle; from within the core domain, two helices act as levers that extend towards (but do not touch) the DNA. Clamp domain, which is inserted between the two subdomains of the core domain at the top of the lever helices; the clamp domain has a beta-sheet structure. ATPase domain (connected to the core domain), which has a classical Walker A motif. HTH (helix-turn-helix) domain, which is involved in dimer contacts.   The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair. Homologues of MutS have been found in many species including eukaryotes (MSH 1, 2, 3, 4, 5, and 6 proteins), archaea and bacteria, and together these proteins have been grouped into the MutS family. Although many of these proteins have similar activities to the E. coli MutS, there is significant diversity of function among the MutS family members. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein [].This diversity is even seen within species, where many species encode multiple MutS homologues with distinct functions []. Inter-species homologues may have arisen through frequent ancient horizontal gene transfer of MutS (and MutL) from bacteria to archaea and eukaryotes via endosymbiotic ancestors of mitochondria and chloroplasts [].  This entry represents the C-terminal domain found in proteins in the MutS family of DNA mismatch repair proteins. The C-terminal region of MutS is comprised of the ATPase domain and the HTH (helix-turn-helix) domain, the latter being involved in dimer contacts. Yeast MSH3 [], bacterial proteins involved in DNA mismatch repair, and the predicted protein product of the Rep-3 gene of mouse share extensive sequence similarity. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. ; GO: 0005524 ATP binding, 0030983 mismatched DNA binding, 0006298 mismatch repair; PDB: 1FW6_A 1EWQ_A 1EWR_B 1NNE_B 2WTU_A 1OH7_A 1OH5_B 1W7A_B 1NG9_A 1OH8_B ....
Probab=29.27  E-value=62  Score=26.49  Aligned_cols=23  Identities=17%  Similarity=0.128  Sum_probs=17.3

Q ss_pred             HHHHHhCCchHHHHH--HHHHHHHh
Q 030241          114 TMSDRIGQMRYIRRW--KIKSLVEA  136 (181)
Q Consensus       114 ~ia~~L~Lp~~v~e~--~i~k~a~~  136 (181)
                      ++|..+|+|+.|+++  ++++++++
T Consensus       210 ~iA~~~g~p~~II~rA~~i~~~l~~  234 (235)
T PF00488_consen  210 EIAKLAGLPEEIIERAKEILKQLEE  234 (235)
T ss_dssp             HHHHHTT--HHHHHHHHHHHHHHHT
T ss_pred             HHHHHhCcCHHHHHHHHHHHHHHhc
Confidence            567889999999999  78888764


No 312
>PF01475 FUR:  Ferric uptake regulator family;  InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins. These are responsible for controlling the intracellular concentration of iron in many bacteria. Although iron is essential for most organisms, high concentrations can be toxic because of the formation of hydroxyl radicals []. FURs can also control zinc homeostasis [] and is the subject of research on the pathogenesis of mycobacteria.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 1MZB_A 2RGV_B 2FE3_B 3F8N_B 3EYY_B 2W57_A 2FU4_A 2O03_A 3MWM_B 2XIG_B ....
Probab=29.24  E-value=27  Score=25.09  Aligned_cols=13  Identities=31%  Similarity=1.012  Sum_probs=10.1

Q ss_pred             CceEeCCCccccc
Q 030241           22 GDTVCSECGLVLE   34 (181)
Q Consensus        22 G~~vC~~CG~Vl~   34 (181)
                      .-.+|..||.|.+
T Consensus        79 ~h~iC~~Cg~v~~   91 (120)
T PF01475_consen   79 HHFICTQCGKVID   91 (120)
T ss_dssp             EEEEETTTS-EEE
T ss_pred             eEEEECCCCCEEE
Confidence            4589999999985


No 313
>PF01921 tRNA-synt_1f:  tRNA synthetases class I (K);  InterPro: IPR002904 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. Lysyl-tRNA synthetase (6.1.1.6 from EC) is an alpha 2 homodimer that belong to both class I and class II. In eubacteria and eukaryota lysyl-tRNA synthetases belong to class II in the same family as aspartyl tRNA synthetase. The class Ic lysyl-tRNA synthetase family is present in archaea and in a number of bacterial groups that include the alphaproteobacteria and spirochaetes[]. A refined crystal structures shows that the active site of LysU is shaped to position the substrates for the nucleophilic attack of the lysine carboxylate on the ATP alpha-phosphate. No residues are directly involved in catalysis, but a number of highly conserved amino acids and three metal ions coordinate the substrates and stabilise the pentavalent transition state. A loop close to the catalytic pocket, disordered in the lysine-bound structure, becomes ordered upon adenine binding [].; GO: 0000166 nucleotide binding, 0004824 lysine-tRNA ligase activity, 0005524 ATP binding, 0006430 lysyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 1IRX_A.
Probab=29.07  E-value=13  Score=32.84  Aligned_cols=34  Identities=26%  Similarity=0.523  Sum_probs=17.1

Q ss_pred             CCCCCCC-CCce--eEe--CCCCceEeCCCccccccCCc
Q 030241            5 FCSDCKK-HTEV--VFD--HSAGDTVCSECGLVLESHSI   38 (181)
Q Consensus         5 ~Cp~Cg~-~~~i--v~D--~~~G~~vC~~CG~Vl~e~~i   38 (181)
                      .|++||. .+..  .+|  ..+=.+.|.+||..-+-.+-
T Consensus       176 iC~~cGri~tt~v~~~d~~~~~v~Y~c~~cG~~g~~~i~  214 (360)
T PF01921_consen  176 ICEKCGRIDTTEVTEYDPEGGTVTYRCEECGHEGEVDIT  214 (360)
T ss_dssp             EETTTEE--EEEEEEE--SSSEEEEE--TTS---EEETT
T ss_pred             eccccCCcccceeeEeecCCCEEEEEecCCCCEEEEecC
Confidence            5999997 2333  334  23345789999998765553


No 314
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=29.05  E-value=47  Score=18.52  Aligned_cols=26  Identities=15%  Similarity=0.557  Sum_probs=13.9

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECG   30 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG   30 (181)
                      .|+.++...-.++=.+.+..+|..|-
T Consensus         2 ~C~~H~~~~~~~fC~~~~~~iC~~C~   27 (39)
T cd00021           2 LCDEHGEEPLSLFCETDRALLCVDCD   27 (39)
T ss_pred             CCCccCCcceEEEeCccChhhhhhcC
Confidence            58888752222333345556666663


No 315
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=28.95  E-value=42  Score=24.53  Aligned_cols=8  Identities=25%  Similarity=0.908  Sum_probs=4.1

Q ss_pred             CCCCCCCC
Q 030241            4 AFCSDCKK   11 (181)
Q Consensus         4 ~~Cp~Cg~   11 (181)
                      ..||.||.
T Consensus        50 t~CP~Cg~   57 (115)
T COG1885          50 TSCPKCGE   57 (115)
T ss_pred             ccCCCCCC
Confidence            34555554


No 316
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair]
Probab=28.83  E-value=40  Score=31.95  Aligned_cols=28  Identities=21%  Similarity=0.535  Sum_probs=15.9

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      .+||.|++..-++.- ..--.+|..-|.+
T Consensus         3 ~~C~~C~g~G~i~v~-~e~c~vc~gtG~~   30 (715)
T COG1107           3 KKCPECGGKGKIVVG-EEECPVCHGTGFS   30 (715)
T ss_pred             ccccccCCCceEeee-eeecccccccccc
Confidence            679999985555442 2223444444555


No 317
>COG2023 RPR2 RNase P subunit RPR2 [Translation, ribosomal structure and biogenesis]
Probab=28.75  E-value=46  Score=24.27  Aligned_cols=31  Identities=23%  Similarity=0.574  Sum_probs=19.6

Q ss_pred             CCCCCCCCC----CceeEeCCCC--ceEeCCCccccc
Q 030241            4 AFCSDCKKH----TEVVFDHSAG--DTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~----~~iv~D~~~G--~~vC~~CG~Vl~   34 (181)
                      .+|+.|.+.    .+...-...|  .+.|.+||.+..
T Consensus        57 ~~CkkC~t~Lvpg~n~rvR~~~~~v~vtC~~CG~~~R   93 (105)
T COG2023          57 TICKKCYTPLVPGKNARVRLRKGRVVVTCLECGTIRR   93 (105)
T ss_pred             HhccccCcccccCcceEEEEcCCeEEEEecCCCcEEE
Confidence            579999862    1222223334  567999999864


No 318
>COG4307 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.73  E-value=24  Score=30.20  Aligned_cols=28  Identities=36%  Similarity=0.940  Sum_probs=21.4

Q ss_pred             CCCCCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            1 MTDAFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         1 m~~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      |..-.||+||.  .+-+|    ...|..||.-|.
T Consensus         1 mk~FhC~~CgQ--~v~Fe----N~~C~~Cg~~Lg   28 (349)
T COG4307           1 MKDFHCPNCGQ--RVAFE----NSACLSCGSALG   28 (349)
T ss_pred             CCcccCCCCCC--eeeec----chHHHhhhhHhh
Confidence            56678999997  35554    468999998876


No 319
>COG2979 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.61  E-value=66  Score=26.46  Aligned_cols=20  Identities=5%  Similarity=0.071  Sum_probs=17.9

Q ss_pred             HHHHHHHHHHhCCchHHHHH
Q 030241          109 FKTIATMSDRIGQMRYIRRW  128 (181)
Q Consensus       109 ~~~I~~ia~~L~Lp~~v~e~  128 (181)
                      +.+++.++.+|+||+.++|.
T Consensus       194 r~YL~~La~~L~L~dalvd~  213 (225)
T COG2979         194 RSYLNALAGALGLPDALVDH  213 (225)
T ss_pred             HHHHHHHHHHhCCCHHHHHH
Confidence            45789999999999999887


No 320
>PF03685 UPF0147:  Uncharacterised protein family (UPF0147);  InterPro: IPR005354 The proteins in this entry are functionally uncharacterised.; PDB: 2QZG_C 2QSB_A.
Probab=28.61  E-value=1.9e+02  Score=20.21  Aligned_cols=50  Identities=14%  Similarity=0.159  Sum_probs=30.9

Q ss_pred             chHHHHHHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh-hCHHHHHHHHHHH
Q 030241          101 PDRGLILAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE-IKTHYWLLACTLL  150 (181)
Q Consensus       101 ~er~l~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~-l~~~~v~AAclYi  150 (181)
                      .|..++++...+++|.+--.+|.+|...  +......+. .....=+|.++++
T Consensus         4 ~e~~i~~~~~~L~~I~~D~sVPRNIRr~a~ea~~~L~~e~~~~~vRaataIs~   56 (85)
T PF03685_consen    4 NEEKIKQAIQMLERIINDTSVPRNIRRAAEEAKEILNNEEESPGVRAATAISI   56 (85)
T ss_dssp             HHHHHHHHHHHHHHHHT-TTS-HHHHHHHHHHHHHCT-TTS-HHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhcCCCCChHHHHHHHHHHHHHhCCCcchhHhHHHHHHH
Confidence            3667889999999999999999999877  444433332 2333334444444


No 321
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases. Helix-turn-helix-containing domain. Also known as Zab.
Probab=28.33  E-value=99  Score=20.11  Aligned_cols=27  Identities=15%  Similarity=0.107  Sum_probs=21.8

Q ss_pred             HHHHHHHHhCCchHHHHHHHHHHHHhh
Q 030241          111 TIATMSDRIGQMRYIRRWKIKSLVEAE  137 (181)
Q Consensus       111 ~I~~ia~~L~Lp~~v~e~~i~k~a~~~  137 (181)
                      ...+||..|||+...+.+.+|++..++
T Consensus        24 ta~eLa~~lgl~~~~v~r~L~~L~~~G   50 (68)
T smart00550       24 TALQLAKNLGLPKKEVNRVLYSLEKKG   50 (68)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHCC
Confidence            367899999999997777778777665


No 322
>PF12651 RHH_3:  Ribbon-helix-helix domain
Probab=28.24  E-value=1.4e+02  Score=17.86  Aligned_cols=22  Identities=14%  Similarity=0.249  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHHhCCchH-HHHH
Q 030241          107 LAFKTIATMSDRIGQMRY-IRRW  128 (181)
Q Consensus       107 ~a~~~I~~ia~~L~Lp~~-v~e~  128 (181)
                      +-+..++.++...|+|.+ ++++
T Consensus        12 el~~~L~~ls~~t~i~~S~Ll~e   34 (44)
T PF12651_consen   12 ELYEKLKELSEETGIPKSKLLRE   34 (44)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHH
Confidence            356799999999999986 4444


No 323
>PRK11032 hypothetical protein; Provisional
Probab=28.19  E-value=27  Score=27.29  Aligned_cols=14  Identities=36%  Similarity=0.790  Sum_probs=12.3

Q ss_pred             CCCceEeCCCcccc
Q 030241           20 SAGDTVCSECGLVL   33 (181)
Q Consensus        20 ~~G~~vC~~CG~Vl   33 (181)
                      .-|.+||.+||.-+
T Consensus       121 g~G~LvC~~Cg~~~  134 (160)
T PRK11032        121 GLGNLVCEKCHHHL  134 (160)
T ss_pred             ecceEEecCCCCEE
Confidence            47999999999987


No 324
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=28.09  E-value=27  Score=29.27  Aligned_cols=39  Identities=26%  Similarity=0.371  Sum_probs=24.2

Q ss_pred             CCCCCCCCCCCc---eeEeCCCC-ceEeCCCcc-ccccCCcccc
Q 030241            3 DAFCSDCKKHTE---VVFDHSAG-DTVCSECGL-VLESHSIDET   41 (181)
Q Consensus         3 ~~~Cp~Cg~~~~---iv~D~~~G-~~vC~~CG~-Vl~e~~id~~   41 (181)
                      ..+|..||....   +......+ -..|..||- +|..+++-.|
T Consensus       122 ~~~C~~C~~~~~~~~~~~~~~~~~~p~C~~Cg~~~lrP~VV~fG  165 (250)
T COG0846         122 RVRCSKCGNQYYDEDVIKFIEDGLIPRCPKCGGPVLRPDVVWFG  165 (250)
T ss_pred             eeEeCCCcCccchhhhhhhcccCCCCcCccCCCccccCCEEEeC
Confidence            357999986221   11112233 467999999 9988876443


No 325
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=28.00  E-value=38  Score=20.39  Aligned_cols=26  Identities=19%  Similarity=0.567  Sum_probs=19.7

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCcccccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVLES   35 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e   35 (181)
                      +|+.|++     .+.....+.|..|+..+=.
T Consensus         1 ~C~vC~~-----~~~~~~~i~C~~C~~~~H~   26 (51)
T PF00628_consen    1 YCPVCGQ-----SDDDGDMIQCDSCNRWYHQ   26 (51)
T ss_dssp             EBTTTTS-----SCTTSSEEEBSTTSCEEET
T ss_pred             eCcCCCC-----cCCCCCeEEcCCCChhhCc
Confidence            4888986     2556778999999987643


No 326
>PF09779 Ima1_N:  Ima1 N-terminal domain;  InterPro: IPR018617  Members of this family of uncharacterised novel proteins have no known function. 
Probab=28.00  E-value=43  Score=25.05  Aligned_cols=28  Identities=21%  Similarity=0.571  Sum_probs=21.0

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      .|-.||..+.+-.+...-...|..|+.+
T Consensus         2 ~C~fC~~~s~~~~~~~~~~w~C~~C~q~   29 (131)
T PF09779_consen    2 NCWFCGQNSKVPYDNRNSNWTCPHCEQY   29 (131)
T ss_pred             eeccCCCCCCCCCCCCCCeeECCCCCCc
Confidence            5999998555555544555999999987


No 327
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=27.91  E-value=35  Score=26.33  Aligned_cols=8  Identities=25%  Similarity=0.700  Sum_probs=4.7

Q ss_pred             CCCCCCCC
Q 030241            4 AFCSDCKK   11 (181)
Q Consensus         4 ~~Cp~Cg~   11 (181)
                      ..||.||+
T Consensus        33 v~CP~Cgs   40 (148)
T PF06676_consen   33 VSCPVCGS   40 (148)
T ss_pred             ccCCCCCC
Confidence            44666665


No 328
>TIGR00575 dnlj DNA ligase, NAD-dependent. The member of this family from Treponema pallidum differs in having three rather than just one copy of the BRCT (BRCA1 C Terminus) domain (pfam00533) at the C-terminus. It is included in the seed.
Probab=27.85  E-value=44  Score=31.83  Aligned_cols=34  Identities=15%  Similarity=0.283  Sum_probs=22.5

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeC--CCccccccCCc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCS--ECGLVLESHSI   38 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~--~CG~Vl~e~~i   38 (181)
                      +..||.||+  .++.+...-.+.|.  .|-.-+..+++
T Consensus       392 P~~CP~C~s--~l~~~~~~~~~~C~n~~C~aq~~~~l~  427 (652)
T TIGR00575       392 PTHCPSCGS--PLVKIEEEAVIRCPNLNCPAQRVERIK  427 (652)
T ss_pred             CCCCCCCCC--EeEecCCcEEEEECCCCCHHHHHHHhH
Confidence            467999997  45555444567896  47666655554


No 329
>PTZ00408 NAD-dependent deacetylase; Provisional
Probab=27.38  E-value=24  Score=29.17  Aligned_cols=39  Identities=21%  Similarity=0.282  Sum_probs=23.4

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCc--cccccCCcccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECG--LVLESHSIDET   41 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG--~Vl~e~~id~~   41 (181)
                      .+.|..|+..-+...+...+...|..||  -++..+++-.|
T Consensus       117 ~~~C~~C~~~~~~~~~~~~~~p~C~~Cg~~g~lrP~vV~FG  157 (242)
T PTZ00408        117 KVRCTATGHVFDWTEDVVHGSSRCKCCGCVGTLRPHIVWFG  157 (242)
T ss_pred             eEEECCCCcccCchhhhhcCCCccccCCCCCCCCCCEEEcC
Confidence            3679999962221112223457799998  56777776543


No 330
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=27.23  E-value=39  Score=27.71  Aligned_cols=38  Identities=18%  Similarity=0.420  Sum_probs=22.6

Q ss_pred             CCCCCCCCCCCceeEeC-CCCceEeCCCccccccCCcccc
Q 030241            3 DAFCSDCKKHTEVVFDH-SAGDTVCSECGLVLESHSIDET   41 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~-~~G~~vC~~CG~Vl~e~~id~~   41 (181)
                      ...|..|+..-. ..+. ......|..||-++..+++-.+
T Consensus       122 ~~~C~~C~~~~~-~~~~~~~~~p~C~~Cgg~lrP~Vv~fg  160 (242)
T PRK00481        122 RARCTKCGQTYD-LDEYLKPEPPRCPKCGGILRPDVVLFG  160 (242)
T ss_pred             ceeeCCCCCCcC-hhhhccCCCCCCCCCCCccCCCeEECC
Confidence            356999985211 1111 1223349999999988876443


No 331
>PRK09263 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=27.22  E-value=34  Score=32.96  Aligned_cols=26  Identities=27%  Similarity=0.606  Sum_probs=14.5

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGL   31 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~   31 (181)
                      .+|++||-...+..+ ..| ..|..||-
T Consensus       642 ~~C~~CG~~Ge~~~~-~~~-~~CP~CG~  667 (711)
T PRK09263        642 DECYECGFTGEFECT-EKG-FTCPKCGN  667 (711)
T ss_pred             cccCCCCCCccccCC-CCC-CcCcCCCC
Confidence            568888852222121 223 57888884


No 332
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=27.18  E-value=44  Score=19.45  Aligned_cols=14  Identities=29%  Similarity=0.672  Sum_probs=9.3

Q ss_pred             CCCceEeCCCcccc
Q 030241           20 SAGDTVCSECGLVL   33 (181)
Q Consensus        20 ~~G~~vC~~CG~Vl   33 (181)
                      .---.+|..||..+
T Consensus        29 ~vp~~~C~~CGE~~   42 (46)
T TIGR03831        29 NVPALVCPQCGEEY   42 (46)
T ss_pred             CCCccccccCCCEe
Confidence            34457788888765


No 333
>TIGR00320 dfx_rbo desulfoferrodoxin. This protein is described in some articles as rubredoxin oxidoreductase (rbo), and its gene shares an operon with the rubredoxin gene in Desulfovibrio vulgaris Hildenborough.
Probab=27.06  E-value=40  Score=25.17  Aligned_cols=26  Identities=27%  Similarity=0.592  Sum_probs=17.5

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      .+|+.||. --.+.+...|+++|  ||.-
T Consensus         8 YkC~~CGn-iv~v~~~g~~~l~C--Cge~   33 (125)
T TIGR00320         8 YKCEVCGN-IVEVLNAGIGQLVC--CNQP   33 (125)
T ss_pred             EECCCCCc-EEEEEECCCcceee--CCcc
Confidence            57999996 33346667778877  4643


No 334
>KOG0856 consensus Predicted pilin-like transcription factor [Posttranslational modification, protein turnover, chaperones]
Probab=27.04  E-value=49  Score=25.39  Aligned_cols=33  Identities=27%  Similarity=0.593  Sum_probs=27.0

Q ss_pred             eCCCCceEeCCCccccc--cCCccccccccccccC
Q 030241           18 DHSAGDTVCSECGLVLE--SHSIDETSEWRTFANE   50 (181)
Q Consensus        18 D~~~G~~vC~~CG~Vl~--e~~id~~~Ewr~F~~~   50 (181)
                      ..+.|-++|..||.-|=  +.-+|.|--|.+|.+.
T Consensus        49 ~~e~GvY~C~~C~~pLykS~tKfdsgcGWPAF~e~   83 (146)
T KOG0856|consen   49 HFEEGVYVCAGCGTPLYKSTTKFDSGCGWPAFFEA   83 (146)
T ss_pred             ccCCceEEEeecCCccccccccccCCCCCchhhhc
Confidence            34899999999998874  4457889999999865


No 335
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=26.77  E-value=34  Score=27.81  Aligned_cols=37  Identities=19%  Similarity=0.420  Sum_probs=23.5

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccccCCcccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDET   41 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~~   41 (181)
                      ...|..|+..  ...+.......|..||-++..+++-.|
T Consensus       118 ~~~C~~C~~~--~~~~~~~~~p~C~~Cgg~lrP~vv~fg  154 (225)
T cd01411         118 RIYCTVCGKT--VDWEEYLKSPYHAKCGGVIRPDIVLYE  154 (225)
T ss_pred             eeEeCCCCCc--cchhhcCCCCCCCCCCCEeCCCEEEcC
Confidence            3569999752  111222224679999999988877544


No 336
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=26.67  E-value=29  Score=26.30  Aligned_cols=13  Identities=46%  Similarity=0.997  Sum_probs=10.4

Q ss_pred             EeCCCccccccCC
Q 030241           25 VCSECGLVLESHS   37 (181)
Q Consensus        25 vC~~CG~Vl~e~~   37 (181)
                      -|++||.|+++..
T Consensus         3 ~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    3 QCTKCGRVFEDGS   15 (131)
T ss_pred             ccCcCCCCcCCCc
Confidence            4999999987654


No 337
>PRK11639 zinc uptake transcriptional repressor; Provisional
Probab=26.47  E-value=31  Score=26.78  Aligned_cols=12  Identities=42%  Similarity=0.891  Sum_probs=10.8

Q ss_pred             ceEeCCCccccc
Q 030241           23 DTVCSECGLVLE   34 (181)
Q Consensus        23 ~~vC~~CG~Vl~   34 (181)
                      -.+|.+||.|++
T Consensus       100 H~iC~~CGki~~  111 (169)
T PRK11639        100 MFICDRCGAVKE  111 (169)
T ss_pred             eEEeCCCCCEEE
Confidence            489999999986


No 338
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=26.41  E-value=38  Score=26.41  Aligned_cols=27  Identities=30%  Similarity=0.716  Sum_probs=15.2

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccccccCCccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDE   40 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~   40 (181)
                      +|..||. ..|        ..|.+|+.=|.-....+
T Consensus        30 fC~kCG~-~tI--------~~Cp~C~~~IrG~y~v~   56 (158)
T PF10083_consen   30 FCSKCGA-KTI--------TSCPNCSTPIRGDYHVE   56 (158)
T ss_pred             HHHHhhH-HHH--------HHCcCCCCCCCCceecC
Confidence            4666765 222        35777776666554443


No 339
>PRK07217 replication factor A; Reviewed
Probab=26.05  E-value=33  Score=29.70  Aligned_cols=21  Identities=33%  Similarity=0.748  Sum_probs=14.9

Q ss_pred             CCCCC--CCCCCceeEeCCCCceEeCCCccc
Q 030241            4 AFCSD--CKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~--Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      .+||+  |+..   +     ....|.+||.|
T Consensus       189 ~rCP~~~C~Rv---l-----~~g~C~~HG~v  211 (311)
T PRK07217        189 KRCPEEDCTRV---L-----QNGRCSEHGKV  211 (311)
T ss_pred             ecCCccccCcc---c-----cCCCCCCCCCc
Confidence            46999  9862   2     22589999977


No 340
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=25.94  E-value=84  Score=17.62  Aligned_cols=27  Identities=22%  Similarity=0.694  Sum_probs=18.8

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      ..|..|+.  .+.+-+.....-|+-|..|
T Consensus         2 ~~C~~C~t--~L~yP~gA~~vrCs~C~~v   28 (31)
T TIGR01053         2 VVCGGCRT--LLMYPRGASSVRCALCQTV   28 (31)
T ss_pred             cCcCCCCc--EeecCCCCCeEECCCCCeE
Confidence            46888874  4555556667778888766


No 341
>KOG3251 consensus Golgi SNAP receptor complex member [Intracellular trafficking, secretion, and vesicular transport]
Probab=25.72  E-value=3.3e+02  Score=22.36  Aligned_cols=27  Identities=19%  Similarity=0.081  Sum_probs=22.8

Q ss_pred             hHHHHHHHHHHHHHHHHhCCchHHHHH
Q 030241          102 DRGLILAFKTIATMSDRIGQMRYIRRW  128 (181)
Q Consensus       102 er~l~~a~~~I~~ia~~L~Lp~~v~e~  128 (181)
                      ..+|..+-++|..+++.|||+.+++.-
T Consensus       156 ~~~L~~~~~ki~~~~ntLGlSn~ti~l  182 (213)
T KOG3251|consen  156 RLTLKGTQKKILDILNTLGLSNQTIRL  182 (213)
T ss_pred             HHHHHHHHHHHHHHHHhcCCcHHHHHH
Confidence            457788999999999999999987554


No 342
>KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton]
Probab=25.58  E-value=20  Score=30.31  Aligned_cols=24  Identities=25%  Similarity=0.598  Sum_probs=18.9

Q ss_pred             CCceEeCCCccccccCCccc-cccc
Q 030241           21 AGDTVCSECGLVLESHSIDE-TSEW   44 (181)
Q Consensus        21 ~G~~vC~~CG~Vl~e~~id~-~~Ew   44 (181)
                      -|-.||..|-.+|+|++|.. |--|
T Consensus       193 mgipiCgaC~rpIeervi~amgKhW  217 (332)
T KOG2272|consen  193 MGIPICGACRRPIEERVIFAMGKHW  217 (332)
T ss_pred             cCCcccccccCchHHHHHHHhcccc
Confidence            57788899999999998854 5555


No 343
>PLN03060 inositol phosphatase-like protein; Provisional
Probab=25.54  E-value=90  Score=25.47  Aligned_cols=27  Identities=4%  Similarity=0.038  Sum_probs=24.1

Q ss_pred             HHHHHHHHhCCchHHHHH--HHHHHHHhh
Q 030241          111 TIATMSDRIGQMRYIRRW--KIKSLVEAE  137 (181)
Q Consensus       111 ~I~~ia~~L~Lp~~v~e~--~i~k~a~~~  137 (181)
                      .++++++.||||..-+++  .+|+.-.++
T Consensus       159 ~l~~l~~~L~ls~~kv~kDL~lYrsnLeK  187 (206)
T PLN03060        159 VLEKLSKALNVSKRSVDRDLDVYRNLLSK  187 (206)
T ss_pred             HHHHHHHHcCCCHHHHHhhHHHHHhHHHH
Confidence            889999999999998888  899987666


No 344
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones]
Probab=25.35  E-value=39  Score=29.58  Aligned_cols=32  Identities=19%  Similarity=0.599  Sum_probs=24.9

Q ss_pred             CCCCCCCC--CCCCCceeEeCCCCceEeCC-Cccccc
Q 030241            1 MTDAFCSD--CKKHTEVVFDHSAGDTVCSE-CGLVLE   34 (181)
Q Consensus         1 m~~~~Cp~--Cg~~~~iv~D~~~G~~vC~~-CG~Vl~   34 (181)
                      |....||.  ||.  .+...++.+..-|.+ ||.+.=
T Consensus       313 ~gGVlCP~pgCG~--gll~EPD~rkvtC~~gCgf~FC  347 (446)
T KOG0006|consen  313 MGGVLCPRPGCGA--GLLPEPDQRKVTCEGGCGFAFC  347 (446)
T ss_pred             cCCEecCCCCCCc--ccccCCCCCcccCCCCchhHhH
Confidence            44567875  885  467788999999998 999874


No 345
>PRK00039 ruvC Holliday junction resolvase; Reviewed
Probab=25.09  E-value=82  Score=24.45  Aligned_cols=63  Identities=8%  Similarity=0.019  Sum_probs=39.6

Q ss_pred             hHHHHHHHHHHHHHHHHhCCchHHHHHHHHHH-HHhhhCHHHHHHHHHHHHHHhCCCCccccChh
Q 030241          102 DRGLILAFKTIATMSDRIGQMRYIRRWKIKSL-VEAEIKTHYWLLACTLLVDKKTSHALLRVQPK  165 (181)
Q Consensus       102 er~l~~a~~~I~~ia~~L~Lp~~v~e~~i~k~-a~~~l~~~~v~AAclYiACR~~~~p~t~~~~~  165 (181)
                      .++|...++.|.++-+..+...-++|..+|.+ ....++. ..+...++.+|.+++.|+..++|.
T Consensus        43 ~~Rl~~I~~~l~~~i~~~~Pd~vaiE~~f~~~n~~sa~~l-~~arGvi~la~~~~~ipv~ey~P~  106 (164)
T PRK00039         43 PERLKQIYDGLSELIDEYQPDEVAIEEVFFNKNPQSALKL-GQARGVAILAAAQRGLPVAEYTPL  106 (164)
T ss_pred             HHHHHHHHHHHHHHHHHhCCCEEEEehhhhccChHHHHHH-HHHHHHHHHHHHHcCCCEEEECHH
Confidence            45677888888888887765545567633332 2222222 225567788999999998755543


No 346
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=25.04  E-value=25  Score=23.17  Aligned_cols=13  Identities=31%  Similarity=0.736  Sum_probs=10.5

Q ss_pred             eEeCCCccccccC
Q 030241           24 TVCSECGLVLESH   36 (181)
Q Consensus        24 ~vC~~CG~Vl~e~   36 (181)
                      +-|-.||.|+.+.
T Consensus         5 iRCFsCGkvi~~~   17 (63)
T COG1644           5 VRCFSCGKVIGHK   17 (63)
T ss_pred             eEeecCCCCHHHH
Confidence            5699999999744


No 347
>COG4393 Predicted membrane protein [Function unknown]
Probab=25.03  E-value=32  Score=30.25  Aligned_cols=27  Identities=19%  Similarity=0.559  Sum_probs=19.9

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .|--||-..-+.   +.+++||-.|+.++-
T Consensus       336 AC~iCGd~GYv~---e~dqvICv~C~Vrmf  362 (405)
T COG4393         336 ACDICGDQGYVM---EGDQVICVRCDVRMF  362 (405)
T ss_pred             HHHhccccceEe---ECCEEEEEEccEEEE
Confidence            488899633333   468999999999873


No 348
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=25.02  E-value=50  Score=19.20  Aligned_cols=30  Identities=23%  Similarity=0.544  Sum_probs=19.4

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      +.+|..|+..  + .....| +.|..|++++-.+
T Consensus        11 ~~~C~~C~~~--i-~~~~~~-~~C~~C~~~~H~~   40 (49)
T smart00109       11 PTKCCVCRKS--I-WGSFQG-LRCSWCKVKCHKK   40 (49)
T ss_pred             CCCccccccc--c-CcCCCC-cCCCCCCchHHHH
Confidence            4679999862  2 222134 7799999987433


No 349
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional
Probab=24.99  E-value=42  Score=29.71  Aligned_cols=34  Identities=24%  Similarity=0.451  Sum_probs=21.7

Q ss_pred             CCCCCCCCCceeEeCCCCceEeCCCccccccCCcccccccc
Q 030241            5 FCSDCKKHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWR   45 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~~id~~~Ewr   45 (181)
                      .|+.|+. ...+..  .....|..||-    +....||=|-
T Consensus       246 ~C~~c~~-~~~~~~--~~~~~C~~c~~----~~~~~GPlW~  279 (382)
T PRK04338        246 YCPKCLY-REEVEG--LPPEECPVCGG----KFGTAGPLWL  279 (382)
T ss_pred             ECCCCCc-EEEecC--CCCCCCCCCCC----cceecccccc
Confidence            5999997 333322  33457999976    4456778773


No 350
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=24.60  E-value=51  Score=29.62  Aligned_cols=10  Identities=30%  Similarity=0.617  Sum_probs=5.8

Q ss_pred             eEeCCCcccc
Q 030241           24 TVCSECGLVL   33 (181)
Q Consensus        24 ~vC~~CG~Vl   33 (181)
                      ..|..||.++
T Consensus       236 a~CpRC~~~L  245 (419)
T PRK15103        236 PVCPRCHTKG  245 (419)
T ss_pred             CCCCCCCCcC
Confidence            3566666665


No 351
>PRK05667 dnaG DNA primase; Validated
Probab=24.59  E-value=73  Score=29.88  Aligned_cols=27  Identities=15%  Similarity=0.320  Sum_probs=23.1

Q ss_pred             CCCCCCCC-CceeEeCCCCceEeCCCcc
Q 030241            5 FCSDCKKH-TEVVFDHSAGDTVCSECGL   31 (181)
Q Consensus         5 ~Cp~Cg~~-~~iv~D~~~G~~vC~~CG~   31 (181)
                      .||.|+.. +++.+++..|..-|-.||.
T Consensus        38 ~CPfH~ektpSf~V~~~k~~~~CF~Cg~   65 (580)
T PRK05667         38 LCPFHDEKTPSFTVSPDKQFYHCFGCGA   65 (580)
T ss_pred             cCCCCCCCCCceEEECCCCeEEECCCCC
Confidence            49999864 3688899999999999996


No 352
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=24.45  E-value=52  Score=18.95  Aligned_cols=9  Identities=11%  Similarity=0.505  Sum_probs=6.2

Q ss_pred             CCCCCCCCC
Q 030241            3 DAFCSDCKK   11 (181)
Q Consensus         3 ~~~Cp~Cg~   11 (181)
                      ...|+.|+.
T Consensus         3 ~~~C~~H~~   11 (42)
T PF00643_consen    3 EPKCPEHPE   11 (42)
T ss_dssp             SSB-SSTTT
T ss_pred             CccCccCCc
Confidence            567999986


No 353
>PHA02956 hypothetical protein; Provisional
Probab=24.42  E-value=49  Score=25.52  Aligned_cols=20  Identities=25%  Similarity=0.793  Sum_probs=18.1

Q ss_pred             CceeEeCCCCceEeCCCccc
Q 030241           13 TEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus        13 ~~iv~D~~~G~~vC~~CG~V   32 (181)
                      ++++.|..+|.++|..=|.+
T Consensus       107 nsiiidsssgkiicegigii  126 (189)
T PHA02956        107 NSIIIDSSSGKIICEGIGII  126 (189)
T ss_pred             ceEEEecCCCcEEeecchHH
Confidence            56999999999999998876


No 354
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=24.35  E-value=64  Score=28.03  Aligned_cols=30  Identities=23%  Similarity=0.452  Sum_probs=21.3

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      .+|=+||.+.+.-.--.-|-.+|.+|--|-
T Consensus        21 k~CaDCga~~P~W~S~nlGvfiCi~CagvH   50 (319)
T COG5347          21 KKCADCGAPNPTWASVNLGVFLCIDCAGVH   50 (319)
T ss_pred             CccccCCCCCCceEecccCeEEEeecchhh
Confidence            568899984333334467889999998774


No 355
>PRK14067 exodeoxyribonuclease VII small subunit; Provisional
Probab=24.22  E-value=1.3e+02  Score=20.63  Aligned_cols=37  Identities=3%  Similarity=-0.112  Sum_probs=27.6

Q ss_pred             CchHHHHHHHHHHHHHHHHhCCchHHHHH--HHHHHHHh
Q 030241          100 NPDRGLILAFKTIATMSDRIGQMRYIRRW--KIKSLVEA  136 (181)
Q Consensus       100 ~~er~l~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~  136 (181)
                      +.+.+...++.+|++|..+|.=++.-.|.  .+|+.+..
T Consensus         4 ~k~~sfEeal~~LEeIV~~LE~~~l~Lees~~lyeeG~~   42 (80)
T PRK14067          4 KKTADFEQQLARLQEIVDALEGGDLPLEESVALYKEGLG   42 (80)
T ss_pred             cccCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
Confidence            34567788999999999999777655555  67776544


No 356
>COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair]
Probab=24.20  E-value=50  Score=31.59  Aligned_cols=36  Identities=22%  Similarity=0.419  Sum_probs=27.2

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCC---CccccccCCccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSE---CGLVLESHSIDE   40 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~---CG~Vl~e~~id~   40 (181)
                      +..||.||+  .++.-.+.-.+-|.+   |-...-|+++-.
T Consensus       404 P~~CP~C~s--~l~r~~~e~~~rC~n~~~C~aq~~e~l~hf  442 (667)
T COG0272         404 PTHCPVCGS--ELVREEGEVVIRCTNGLNCPAQLKERLIHF  442 (667)
T ss_pred             CCCCCCCCC--eeEeccCceeEecCCCCCChHHHhhheeeE
Confidence            467999997  465544566788987   988888888653


No 357
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=24.08  E-value=45  Score=19.85  Aligned_cols=8  Identities=38%  Similarity=0.958  Sum_probs=4.4

Q ss_pred             CCCCCCCC
Q 030241            4 AFCSDCKK   11 (181)
Q Consensus         4 ~~Cp~Cg~   11 (181)
                      ..||.||+
T Consensus         3 ~~C~~Cg~   10 (47)
T PF13005_consen    3 RACPDCGG   10 (47)
T ss_pred             CcCCCCCc
Confidence            44666654


No 358
>PRK04330 hypothetical protein; Provisional
Probab=24.00  E-value=2.7e+02  Score=19.66  Aligned_cols=51  Identities=14%  Similarity=0.147  Sum_probs=36.0

Q ss_pred             CchHHHHHHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh-hCHHHHHHHHHHH
Q 030241          100 NPDRGLILAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE-IKTHYWLLACTLL  150 (181)
Q Consensus       100 ~~er~l~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~-l~~~~v~AAclYi  150 (181)
                      ..|..++++...+++|.+--.+|.+|+..  +......+. .....=+|.++++
T Consensus         6 ~~e~~ik~~~~~L~~I~~D~sVPRNIRraa~ea~~~L~~e~~~~~vRaA~AIs~   59 (88)
T PRK04330          6 DNEEKIKQAIQMLEEIINDTSVPRNIRRAATEAKEILLNEEESPGVRAATAISI   59 (88)
T ss_pred             chHHHHHHHHHHHHHHhcCCCCChHHHHHHHHHHHHHhCcCcchhHHHHHHHHH
Confidence            45778899999999999999999999877  555554443 3344444445544


No 359
>PRK05550 bifunctional methionine sulfoxide reductase B/A protein; Provisional
Probab=23.92  E-value=56  Score=27.95  Aligned_cols=33  Identities=24%  Similarity=0.614  Sum_probs=27.1

Q ss_pred             eCCCCceEeCCCccccc--cCCccccccccccccC
Q 030241           18 DHSAGDTVCSECGLVLE--SHSIDETSEWRTFANE   50 (181)
Q Consensus        18 D~~~G~~vC~~CG~Vl~--e~~id~~~Ewr~F~~~   50 (181)
                      ..+.|.++|..||.-|=  +.-+|+|.-|.+|.+.
T Consensus        31 ~~~~G~y~c~~c~~~LF~s~~Kf~sg~GWPsF~~~   65 (283)
T PRK05550         31 HDEKGVYLCRRCGAPLFRSEDKFNSGCGWPSFDDE   65 (283)
T ss_pred             CCCCcEEEcCCCCchhcCChhhccCCCCCcCcCcc
Confidence            45899999999999884  4457889999999753


No 360
>TIGR00617 rpa1 replication factor-a protein 1 (rpa1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.91  E-value=55  Score=30.88  Aligned_cols=27  Identities=30%  Similarity=0.744  Sum_probs=20.5

Q ss_pred             CCCCC--CCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSD--CKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~--Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      ..||.  |++.   +.+...|.+.|..|+...
T Consensus       475 ~ACp~~~CnKK---V~~~~~g~~~CekC~~~~  503 (608)
T TIGR00617       475 RACPSEDCNKK---VVDQGDGTYRCEKCNKNF  503 (608)
T ss_pred             ccCChhhCCCc---cccCCCCCEECCCCCCCC
Confidence            35987  9873   345667999999999765


No 361
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=23.90  E-value=32  Score=28.19  Aligned_cols=31  Identities=23%  Similarity=0.574  Sum_probs=18.8

Q ss_pred             CCCCCCCC-CceeE-eCCCCceEeCCCcccccc
Q 030241            5 FCSDCKKH-TEVVF-DHSAGDTVCSECGLVLES   35 (181)
Q Consensus         5 ~Cp~Cg~~-~~iv~-D~~~G~~vC~~CG~Vl~e   35 (181)
                      .|+.|=-. .+++. +..---.+|..||.....
T Consensus        15 lC~~C~~~~~~i~ei~~~i~v~~C~~Cg~~~~~   47 (236)
T PF04981_consen   15 LCPDCYLKRFDIIEIPDRIEVTICPKCGRYRIG   47 (236)
T ss_pred             cChHHhcccCCeeecCCccCceECCCCCCEECC
Confidence            46666321 22322 223477899999999865


No 362
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=23.89  E-value=47  Score=21.47  Aligned_cols=7  Identities=57%  Similarity=1.421  Sum_probs=3.3

Q ss_pred             EeCCCcc
Q 030241           25 VCSECGL   31 (181)
Q Consensus        25 vC~~CG~   31 (181)
                      +|.+||-
T Consensus        43 ~CPNCgG   49 (57)
T PF06906_consen   43 VCPNCGG   49 (57)
T ss_pred             cCcCCCC
Confidence            4555543


No 363
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=23.69  E-value=17  Score=28.86  Aligned_cols=31  Identities=29%  Similarity=0.605  Sum_probs=20.4

Q ss_pred             CCCCCCCCCCceeEeC-CCCceEeCCCccccccC
Q 030241            4 AFCSDCKKHTEVVFDH-SAGDTVCSECGLVLESH   36 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~-~~G~~vC~~CG~Vl~e~   36 (181)
                      -.||.|...  .-+|. -.-.-.|+.||-+|++.
T Consensus       114 y~C~~~~~r--~sfdeA~~~~F~Cp~Cg~~L~~~  145 (176)
T COG1675         114 YVCPNCHVK--YSFDEAMELGFTCPKCGEDLEEY  145 (176)
T ss_pred             eeCCCCCCc--ccHHHHHHhCCCCCCCCchhhhc
Confidence            359988853  44554 22337899999998643


No 364
>PF11020 DUF2610:  Domain of unknown function (DUF2610);  InterPro: IPR021277  This family is conserved in Proteobacteria. One member is annotated as being elongation factor P but this could not be confirmed. 
Probab=23.55  E-value=2e+02  Score=19.94  Aligned_cols=25  Identities=8%  Similarity=-0.031  Sum_probs=14.1

Q ss_pred             CCchHHHHH--HHHHHHHhh-hCHHHHH
Q 030241          120 GQMRYIRRW--KIKSLVEAE-IKTHYWL  144 (181)
Q Consensus       120 ~Lp~~v~e~--~i~k~a~~~-l~~~~v~  144 (181)
                      .+|+.|.|.  .+|++|.+. +..+.++
T Consensus        45 ~IP~~V~~sl~kL~~La~~N~v~feeLc   72 (82)
T PF11020_consen   45 QIPEKVMDSLSKLYKLAKENNVSFEELC   72 (82)
T ss_pred             CCCHHHHHHHHHHHHHHHHcCCCHHHHH
Confidence            356666666  566666555 4444443


No 365
>PRK14715 DNA polymerase II large subunit; Provisional
Probab=22.90  E-value=42  Score=34.74  Aligned_cols=23  Identities=35%  Similarity=0.605  Sum_probs=17.4

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      .+||.||.. .       =...|..||.-.+
T Consensus       675 ~~Cp~Cg~~-~-------~~~~Cp~CG~~~~  697 (1627)
T PRK14715        675 FKCPKCGKV-G-------LYHVCPFCGTRVE  697 (1627)
T ss_pred             eeCCCCCCc-c-------ccccCcccCCccc
Confidence            579999962 2       2579999998754


No 366
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=22.84  E-value=54  Score=29.32  Aligned_cols=37  Identities=19%  Similarity=0.390  Sum_probs=24.3

Q ss_pred             EeCCCCceEeCCCccccccCCccccccccccccCCCCCCCccccCCC
Q 030241           17 FDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPT   63 (181)
Q Consensus        17 ~D~~~G~~vC~~CG~Vl~e~~id~~~Ewr~F~~~~~~~d~sr~G~p~   63 (181)
                      .|...+-..|.+||.|++...+..+.          ...=.|+|...
T Consensus         7 ~~~~~~~~~C~~Cd~l~~~~~l~~g~----------~a~CpRCg~~L   43 (403)
T TIGR00155         7 HHPAAKHILCSQCDMLVALPRIESGQ----------KAACPRCGTTL   43 (403)
T ss_pred             cCCCCCeeeCCCCCCcccccCCCCCC----------eeECCCCCCCC
Confidence            35566777899999998766554332          12356787654


No 367
>COG5319 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.74  E-value=33  Score=25.97  Aligned_cols=11  Identities=36%  Similarity=0.866  Sum_probs=5.3

Q ss_pred             CceEeCCCccc
Q 030241           22 GDTVCSECGLV   32 (181)
Q Consensus        22 G~~vC~~CG~V   32 (181)
                      |.+.|..||..
T Consensus        31 gLv~CPvCgs~   41 (142)
T COG5319          31 GLVTCPVCGST   41 (142)
T ss_pred             CceeCCCCCcH
Confidence            34445555544


No 368
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=22.44  E-value=49  Score=19.49  Aligned_cols=31  Identities=23%  Similarity=0.541  Sum_probs=19.6

Q ss_pred             CCCCCCCCCCCceeEeCCCCceEeCCCccccccC
Q 030241            3 DAFCSDCKKHTEVVFDHSAGDTVCSECGLVLESH   36 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~e~   36 (181)
                      +.+|..|++.  + .....--+.|..|++++-.+
T Consensus        11 ~~~C~~C~~~--i-~~~~~~~~~C~~C~~~~H~~   41 (50)
T cd00029          11 PTFCDVCRKS--I-WGLFKQGLRCSWCKVKCHKK   41 (50)
T ss_pred             CCChhhcchh--h-hccccceeEcCCCCCchhhh
Confidence            4578899862  2 22223446799999987543


No 369
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=22.38  E-value=59  Score=28.19  Aligned_cols=11  Identities=45%  Similarity=0.908  Sum_probs=9.8

Q ss_pred             CCCCCCCCCCC
Q 030241            1 MTDAFCSDCKK   11 (181)
Q Consensus         1 m~~~~Cp~Cg~   11 (181)
                      |....||.|++
T Consensus         1 md~~~CP~Ck~   11 (309)
T TIGR00570         1 MDDQGCPRCKT   11 (309)
T ss_pred             CCCCCCCcCCC
Confidence            78889999997


No 370
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional
Probab=22.33  E-value=68  Score=29.81  Aligned_cols=33  Identities=21%  Similarity=0.233  Sum_probs=26.9

Q ss_pred             eCCCCceEeCCCccccc--cCCccccccccccccC
Q 030241           18 DHSAGDTVCSECGLVLE--SHSIDETSEWRTFANE   50 (181)
Q Consensus        18 D~~~G~~vC~~CG~Vl~--e~~id~~~Ewr~F~~~   50 (181)
                      ..+.|.++|..||.-|=  +.-+|+|.-|.+|.+.
T Consensus       413 ~~~~G~y~c~~c~~pLf~s~~Kf~sg~GWPsF~~~  447 (521)
T PRK14018        413 LFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRP  447 (521)
T ss_pred             CCCCEEEEecCCCCccccCcccccCCCCCcccCcc
Confidence            35899999999999874  4457889999999853


No 371
>PLN00047 photosystem II biogenesis protein Psb29; Provisional
Probab=22.23  E-value=1.1e+02  Score=26.26  Aligned_cols=28  Identities=0%  Similarity=-0.020  Sum_probs=24.0

Q ss_pred             HHHHHHHHHhCCchHHHHH--HHHHHHHhh
Q 030241          110 KTIATMSDRIGQMRYIRRW--KIKSLVEAE  137 (181)
Q Consensus       110 ~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~  137 (181)
                      +.++++++.|||+..-+++  .+|+.-.++
T Consensus       211 ~~l~~l~e~Lgls~~kv~KDLdlYrsnLeK  240 (283)
T PLN00047        211 TALEKLCAALNINKRSVDRDLDVYRGLLSK  240 (283)
T ss_pred             HHHHHHHHHcCCCHHHHHhhHHHHHhHHHH
Confidence            3889999999999998888  899876665


No 372
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair]
Probab=22.21  E-value=52  Score=33.77  Aligned_cols=31  Identities=39%  Similarity=0.845  Sum_probs=21.5

Q ss_pred             CCCCCCCCCCCceeEeCCCC------ceEeCCCccccc
Q 030241            3 DAFCSDCKKHTEVVFDHSAG------DTVCSECGLVLE   34 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~D~~~G------~~vC~~CG~Vl~   34 (181)
                      ...||+|+- .+++.|...|      +--|..||.=+.
T Consensus       914 HY~Cp~Cky-~Ef~~d~svgsGfDLpdK~CPkCg~pl~  950 (1444)
T COG2176         914 HYLCPECKY-SEFIDDGSVGSGFDLPDKDCPKCGTPLK  950 (1444)
T ss_pred             cccCCCCce-eeeecCCCcCCCCCCCCCCCCcCCCccc
Confidence            457999985 6777766444      346888887653


No 373
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=22.16  E-value=51  Score=26.68  Aligned_cols=38  Identities=16%  Similarity=0.407  Sum_probs=21.5

Q ss_pred             CCCCCCCCCCCceeE--eC-CCCceEeCCCccccccCCccc
Q 030241            3 DAFCSDCKKHTEVVF--DH-SAGDTVCSECGLVLESHSIDE   40 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~--D~-~~G~~vC~~CG~Vl~e~~id~   40 (181)
                      ...|..|+...+...  .. ......|..||-++..+++-.
T Consensus       113 ~~~C~~C~~~~~~~~~~~~~~~~~p~C~~Cgg~lrP~Vv~f  153 (222)
T cd01413         113 TAYCVNCGSKYDLEEVKYAKKHEVPRCPKCGGIIRPDVVLF  153 (222)
T ss_pred             cceECCCCCCcchhHHHHhccCCCCcCCCCCCccCCCEEEC
Confidence            356888886211100  01 122457888988887776643


No 374
>PF08996 zf-DNA_Pol:  DNA Polymerase alpha zinc finger;  InterPro: IPR015088 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNA Polymerase alpha zinc finger domain adopts an alpha-helix-like structure, followed by three turns, all of which involve proline. The resulting motif is a helix-turn-helix motif, in contrast to other zinc finger domains, which show anti-parallel sheet and helix conformation. Zinc binding occurs due to the presence of four cysteine residues positioned to bind the metal centre in a tetrahedral coordination geometry. The function of this domain is uncertain: it has been proposed that the zinc finger motif may be an essential part of the DNA binding domain [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0001882 nucleoside binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3FLO_D 1N5G_A 1K0P_A 1K18_A.
Probab=21.82  E-value=64  Score=25.51  Aligned_cols=34  Identities=26%  Similarity=0.529  Sum_probs=16.0

Q ss_pred             CCCCCCCCCCceeEeC---------CCCceEeCCCccccccCCcc
Q 030241            4 AFCSDCKKHTEVVFDH---------SAGDTVCSECGLVLESHSID   39 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~---------~~G~~vC~~CG~Vl~e~~id   39 (181)
                      ..||.||.  ...++.         ...-..|.+|+..+....|.
T Consensus        19 ~~C~~C~~--~~~f~g~~~~~~~~~~~~~~~C~~C~~~~~~~~l~   61 (188)
T PF08996_consen   19 LTCPSCGT--EFEFPGVFEEDGDDVSPSGLQCPNCSTPLSPASLV   61 (188)
T ss_dssp             EE-TTT----EEEE-SSS--SSEEEETTEEEETTT--B--HHHHH
T ss_pred             eECCCCCC--CccccccccCCccccccCcCcCCCCCCcCCHHHHH
Confidence            46999996  233332         23468999999977654443


No 375
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.81  E-value=15  Score=25.25  Aligned_cols=29  Identities=34%  Similarity=0.667  Sum_probs=12.9

Q ss_pred             CCCCCCCCCceeEeC-CCCceEeCCCcccc
Q 030241            5 FCSDCKKHTEVVFDH-SAGDTVCSECGLVL   33 (181)
Q Consensus         5 ~Cp~Cg~~~~iv~D~-~~G~~vC~~CG~Vl   33 (181)
                      .|.+||...+++.-. +.-.+.|.+||--+
T Consensus        14 ~c~~cg~~~dvvq~~~ddplt~ce~c~a~~   43 (82)
T COG2331          14 ECTECGNRFDVVQAMTDDPLTTCEECGARL   43 (82)
T ss_pred             eecccchHHHHHHhcccCccccChhhChHH
Confidence            366666422222111 33455666666533


No 376
>PF00196 GerE:  Bacterial regulatory proteins, luxR family;  InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators. The domain is named after Vibrio fischeri luxR, a transcriptional activator for quorum-sensing control of luminescence. LuxR-type HTH domain proteins occur in a variety of organisms. The DNA-binding HTH domain is usually located in the C-terminal region; the N-terminal region often containing an autoinducer-binding domain or a response regulatory domain. Most luxR-type regulators act as transcription activators, but some can be repressors or have a dual role for different sites. LuxR-type HTH regulators control a wide variety of activities in various biological processes. The luxR-type, DNA-binding HTH domain forms a four-helical bundle structure. The HTH motif comprises the second and third helices, known as the scaffold and recognition helix, respectively. The HTH binds DNA in the major groove, where the N-terminal part of the recognition helix makes most of the DNA contacts. The fourth helix is involved in dimerisation of gerE and traR. Signalling events by one of the four activation mechanisms described below lead to multimerisation of the regulator. The regulators bind DNA as multimers [, , ]. LuxR-type HTH proteins can be activated by one of four different mechanisms: 1) Regulators which belong to a two-component sensory transduction system where the protein is activated by its phosphorylation, generally on an aspartate residue, by a transmembrane kinase [, ]. Some proteins that belong to this category are:  Rhizobiaceae fixJ (global regulator inducing expression of nitrogen-fixation genes in microaerobiosis)  Escherichia coli and Salmonella typhimurium uhpA (activates hexose phosphate transport gene uhpT) E. coli narL and narP (activate nitrate reductase operon) Enterobacteria rcsB (regulation of exopolysaccharide biosynthesis in enteric and plant pathogenesis)  Bordetella pertussis bvgA (virulence factor)  Bacillus subtilis coma (involved in expression of late-expressing competence genes) 2) Regulators which are activated, or in very rare cases repressed, when bound to N-acyl homoserine lactones, which are used as quorum sensing molecules in a variety of Gram-negative bacteria []: V. fischeri luxR (activates bioluminescence operon)  Agrobacterium tumefaciens traR (regulation of Ti plasmid transfer)  Erwinia carotovora carR (control of carbapenem antibiotics biosynthesis) E. carotovora expR (virulence factor for soft rot disease; activates plant tissue macerating enzyme genes)  Pseudomonas aeruginosa lasR (activates elastase gene lasB)  Erwinia chrysanthemi echR and Erwinia stewartii esaR  Pseudomonas chlororaphis phzR (positive regulator of phenazine antibiotic production)  Pseudomonas aeruginosa rhlR (activates rhlAB operon and lasB gene) 3) Autonomous effector domain regulators, without a regulatory domain, represented by gerE []. B. subtilis gerE (transcription activator and repressor for the regulation of spore formation) 4) Multiple ligand-binding regulators, exemplified by malT []. E. coli malT (activates maltose operon; MalT binds ATP and maltotriose); GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 3SZT_A 3CLO_A 1H0M_A 1L3L_A 3C57_B 1ZLK_B 1ZLJ_H 3C3W_B 1RNL_A 1ZG1_A ....
Probab=21.62  E-value=1.4e+02  Score=18.33  Aligned_cols=24  Identities=8%  Similarity=0.158  Sum_probs=16.3

Q ss_pred             HHHHHHHHhCCchHHHHH---HHHHHH
Q 030241          111 TIATMSDRIGQMRYIRRW---KIKSLV  134 (181)
Q Consensus       111 ~I~~ia~~L~Lp~~v~e~---~i~k~a  134 (181)
                      ...+||..|+++..-+..   .++++.
T Consensus        20 ~~~eIA~~l~is~~tV~~~~~~i~~Kl   46 (58)
T PF00196_consen   20 SNKEIAEELGISEKTVKSHRRRIMKKL   46 (58)
T ss_dssp             -HHHHHHHHTSHHHHHHHHHHHHHHHH
T ss_pred             CcchhHHhcCcchhhHHHHHHHHHHHh
Confidence            467888889888765555   566654


No 377
>COG4189 Predicted transcriptional regulator [Transcription]
Probab=21.61  E-value=89  Score=26.38  Aligned_cols=18  Identities=6%  Similarity=0.146  Sum_probs=15.9

Q ss_pred             HHHHHHHHhCCchHHHHH
Q 030241          111 TIATMSDRIGQMRYIRRW  128 (181)
Q Consensus       111 ~I~~ia~~L~Lp~~v~e~  128 (181)
                      .++++|..||||+++...
T Consensus        39 NvneiAe~lgLpqst~s~   56 (308)
T COG4189          39 NVNEIAEALGLPQSTMSA   56 (308)
T ss_pred             CHHHHHHHhCCchhhhhh
Confidence            588999999999988776


No 378
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=21.61  E-value=49  Score=31.35  Aligned_cols=21  Identities=29%  Similarity=0.692  Sum_probs=13.3

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGL   31 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~   31 (181)
                      .+|++||- .- +.     ...|..||-
T Consensus       560 ~~C~~CGy-~g-~~-----~~~CP~CG~  580 (618)
T PRK14704        560 DRCKCCSY-HG-VI-----GNECPSCGN  580 (618)
T ss_pred             eecCCCCC-CC-Cc-----CccCcCCCC
Confidence            56888884 21 11     168888885


No 379
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class. This model represents a class of homoebox domain that differs substantially from the typical homoebox domain described in pfam model pfam00046. It is found in both C4 and C3 plants.
Probab=21.34  E-value=80  Score=20.36  Aligned_cols=17  Identities=18%  Similarity=0.380  Sum_probs=14.1

Q ss_pred             HHHHHHHHHhCCchHHH
Q 030241          110 KTIATMSDRIGQMRYIR  126 (181)
Q Consensus       110 ~~I~~ia~~L~Lp~~v~  126 (181)
                      ..++++|..|||+..++
T Consensus        33 ~~r~~la~~lgl~~~vv   49 (58)
T TIGR01565        33 EEVREFCEEIGVTRKVF   49 (58)
T ss_pred             HHHHHHHHHhCCCHHHe
Confidence            37889999999998764


No 380
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=21.30  E-value=46  Score=23.12  Aligned_cols=42  Identities=19%  Similarity=0.329  Sum_probs=26.6

Q ss_pred             CCCCCCCCCCc------eeEeCCCCceEeCCCccccccCCccccccccccc
Q 030241            4 AFCSDCKKHTE------VVFDHSAGDTVCSECGLVLESHSIDETSEWRTFA   48 (181)
Q Consensus         4 ~~Cp~Cg~~~~------iv~D~~~G~~vC~~CG~Vl~e~~id~~~Ewr~F~   48 (181)
                      |.|-+||.+-+      +..|..+-.-.|..|-.|. +-+.+.|.+  .|-
T Consensus         1 ~~C~HCg~~~p~~~~~~~~~~g~~~~FCC~GC~~V~-~~i~~~gL~--~yY   48 (88)
T PF12156_consen    1 MKCYHCGLPVPEGAKITVEIDGEERPFCCPGCQAVY-QLIHENGLE--SYY   48 (88)
T ss_pred             CCCCCCCCCCCCCCCeeeeeCCCccccccHHHHHHH-HHHHHcchH--HHH
Confidence            46999997421      2233344589999999996 344455554  454


No 381
>cd08313 Death_TNFR1 Death domain of Tumor Necrosis Factor Receptor 1. Death Domain (DD) found in tumor necrosis factor receptor-1 (TNFR-1). TNFR-1 has many names including TNFRSF1A, CD120a, p55, p60, and TNFR60. It activates two major intracellular signaling pathways that lead to the activation of the transcription factor NF-kB and the induction of cell death. Upon binding of its ligand TNF, TNFR-1 trimerizes which leads to the recruitment of an adaptor protein named TNFR-associated death domain protein (TRADD) through a DD/DD interaction. Mutations in the TNFRSF1A gene causes TNFR-associated periodic syndrome (TRAPS), a rare disorder characterized recurrent fever, myalgia, abdominal pain, conjunctivitis and skin eruptions. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation a
Probab=21.16  E-value=1.2e+02  Score=20.76  Aligned_cols=20  Identities=10%  Similarity=-0.001  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHhCCchHHHHH
Q 030241          109 FKTIATMSDRIGQMRYIRRW  128 (181)
Q Consensus       109 ~~~I~~ia~~L~Lp~~v~e~  128 (181)
                      ++.-.+++.+|||+++.+|.
T Consensus        11 ~~~wk~~~R~LGlse~~Id~   30 (80)
T cd08313          11 PRRWKEFVRRLGLSDNEIER   30 (80)
T ss_pred             HHHHHHHHHHcCCCHHHHHH
Confidence            34677899999999998887


No 382
>PF05864 Chordopox_RPO7:  Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7);  InterPro: IPR008448 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of several Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide sequences. DNA-dependent RNA polymerase catalyses the transcription of DNA into RNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=21.12  E-value=38  Score=22.02  Aligned_cols=13  Identities=46%  Similarity=0.871  Sum_probs=10.0

Q ss_pred             ceEeCCCcccccc
Q 030241           23 DTVCSECGLVLES   35 (181)
Q Consensus        23 ~~vC~~CG~Vl~e   35 (181)
                      .+||+.||.=+.|
T Consensus         4 ~lvCSTCGrDlSe   16 (63)
T PF05864_consen    4 QLVCSTCGRDLSE   16 (63)
T ss_pred             eeeecccCCcchH
Confidence            4799999987643


No 383
>PF04031 Las1:  Las1-like ;  InterPro: IPR007174 Las1 is an essential nuclear protein involved in cell morphogenesis and cell surface growth [].
Probab=21.08  E-value=81  Score=24.27  Aligned_cols=19  Identities=21%  Similarity=0.478  Sum_probs=17.1

Q ss_pred             HHHHHHHHHhCCchHHHHH
Q 030241          110 KTIATMSDRIGQMRYIRRW  128 (181)
Q Consensus       110 ~~I~~ia~~L~Lp~~v~e~  128 (181)
                      .-|..+|..+|||..++|-
T Consensus       102 ~si~~~A~~iglP~~lVdl  120 (154)
T PF04031_consen  102 RSIASLAKEIGLPSWLVDL  120 (154)
T ss_pred             hhHHHHHHHcCCCHHHHHH
Confidence            5889999999999998875


No 384
>PHA03082 DNA-dependent RNA polymerase subunit; Provisional
Probab=21.02  E-value=38  Score=22.06  Aligned_cols=13  Identities=46%  Similarity=0.871  Sum_probs=10.1

Q ss_pred             ceEeCCCcccccc
Q 030241           23 DTVCSECGLVLES   35 (181)
Q Consensus        23 ~~vC~~CG~Vl~e   35 (181)
                      .+||+.||.=+.|
T Consensus         4 ~lVCsTCGrDlSe   16 (63)
T PHA03082          4 QLVCSTCGRDLSE   16 (63)
T ss_pred             eeeecccCcchhH
Confidence            4799999987653


No 385
>PF10668 Phage_terminase:  Phage terminase small subunit;  InterPro: IPR018925  This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes. Packaging of double-stranded viral DNA concatemers requires interaction of the prohead with virus DNA. This process is mediated by a phage-encoded DNA recognition and terminase protein. The terminase enzymes described so far, which are hetero-oligomers composed of a small and a large subunit, do not have a significant level of sequence homology. The small terminase subunit is thought to form a nucleoprotein structure that helps to position the terminase large subunit at the packaging initiation site [].
Probab=20.96  E-value=1.8e+02  Score=18.95  Aligned_cols=18  Identities=11%  Similarity=0.274  Sum_probs=14.8

Q ss_pred             HHHHHHHHhCCchHHHHH
Q 030241          111 TIATMSDRIGQMRYIRRW  128 (181)
Q Consensus       111 ~I~~ia~~L~Lp~~v~e~  128 (181)
                      .+.+||+.||++...+..
T Consensus        24 ~lkdIA~~Lgvs~~tIr~   41 (60)
T PF10668_consen   24 KLKDIAEKLGVSESTIRK   41 (60)
T ss_pred             cHHHHHHHHCCCHHHHHH
Confidence            688999999999876544


No 386
>TIGR00201 comF comF family protein. This protein is found in species that do (Bacillus subtilis, Haemophilus influenzae) or do not (E. coli, Borrelia burgdorferi) have described systems for natural transformation with exogenous DNA. It is involved in competence for transformation in Bacillus subtilis.
Probab=20.95  E-value=42  Score=26.32  Aligned_cols=23  Identities=26%  Similarity=0.644  Sum_probs=16.3

Q ss_pred             CCCCCCCCceeEeCCCCceEeCCCccccc
Q 030241            6 CSDCKKHTEVVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus         6 Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      |+.||.  .+.    .++.+|.+|+.-+.
T Consensus         1 C~~C~~--~~~----~~~~~C~~C~~~~~   23 (190)
T TIGR00201         1 CSLCGR--PYQ----SVHALCRQCGSWRT   23 (190)
T ss_pred             CCcccc--ccc----cccCCchhhCCccc
Confidence            999996  222    23579999987664


No 387
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=20.77  E-value=44  Score=24.35  Aligned_cols=11  Identities=36%  Similarity=1.084  Sum_probs=8.0

Q ss_pred             EeCCCcccccc
Q 030241           25 VCSECGLVLES   35 (181)
Q Consensus        25 vC~~CG~Vl~e   35 (181)
                      .|+.||.|.++
T Consensus         4 ~CtrCG~vf~~   14 (112)
T COG3364           4 QCTRCGEVFDD   14 (112)
T ss_pred             eeccccccccc
Confidence            57888888764


No 388
>PHA02325 hypothetical protein
Probab=20.74  E-value=51  Score=21.95  Aligned_cols=11  Identities=27%  Similarity=0.827  Sum_probs=7.3

Q ss_pred             CCCCCCCCCCC
Q 030241            1 MTDAFCSDCKK   11 (181)
Q Consensus         1 m~~~~Cp~Cg~   11 (181)
                      |....||.|+.
T Consensus         1 m~~k~CPkC~A   11 (72)
T PHA02325          1 MDTKICPKCGA   11 (72)
T ss_pred             CCccccCccCC
Confidence            55666777774


No 389
>PTZ00073 60S ribosomal protein L37; Provisional
Probab=20.52  E-value=47  Score=23.54  Aligned_cols=23  Identities=26%  Similarity=0.816  Sum_probs=15.6

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGL   31 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~   31 (181)
                      ..|..||. ...  .  --.-.|..||+
T Consensus        17 tlCrRCG~-~sy--H--~qK~~CasCGy   39 (91)
T PTZ00073         17 TLCRRCGK-RSF--H--VQKKRCASCGY   39 (91)
T ss_pred             chhcccCc-ccc--c--cccccchhcCC
Confidence            56999997 332  2  12456999998


No 390
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=20.50  E-value=55  Score=26.30  Aligned_cols=39  Identities=21%  Similarity=0.331  Sum_probs=23.4

Q ss_pred             CCCCCCCCCCCceeE---e-CCCCceEeCCCccccccCCcccc
Q 030241            3 DAFCSDCKKHTEVVF---D-HSAGDTVCSECGLVLESHSIDET   41 (181)
Q Consensus         3 ~~~Cp~Cg~~~~iv~---D-~~~G~~vC~~CG~Vl~e~~id~~   41 (181)
                      ...|..|+.......   . .......|..||-.+..+++-.+
T Consensus       109 ~~~C~~C~~~~~~~~~~~~~~~~~~p~C~~Cg~~lrP~Vv~fg  151 (218)
T cd01407         109 RVRCTKCGKEYPRDELQADIDREEVPRCPKCGGLLRPDVVFFG  151 (218)
T ss_pred             cceeCCCcCCCcHHHHhHhhccCCCCcCCCCCCccCCCeEECC
Confidence            367999986311100   0 12234679999999888876443


No 391
>PF06056 Terminase_5:  Putative ATPase subunit of terminase (gpP-like);  InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after []. Terminases are viral proteins that are involved in packaging viral DNA into the capsid.; GO: 0005524 ATP binding, 0019069 viral capsid assembly
Probab=20.45  E-value=92  Score=19.89  Aligned_cols=18  Identities=17%  Similarity=0.229  Sum_probs=14.0

Q ss_pred             HHHHHHHHhCCchHHHHH
Q 030241          111 TIATMSDRIGQMRYIRRW  128 (181)
Q Consensus       111 ~I~~ia~~L~Lp~~v~e~  128 (181)
                      .+.+||+.||+|...+-.
T Consensus        15 ~~~eIA~~Lg~~~~TV~~   32 (58)
T PF06056_consen   15 SIKEIAEELGVPRSTVYS   32 (58)
T ss_pred             CHHHHHHHHCCChHHHHH
Confidence            578999999999665443


No 392
>PLN03165 chaperone protein dnaJ-related; Provisional
Probab=20.43  E-value=58  Score=23.90  Aligned_cols=7  Identities=29%  Similarity=0.743  Sum_probs=4.3

Q ss_pred             CCCCCCC
Q 030241            5 FCSDCKK   11 (181)
Q Consensus         5 ~Cp~Cg~   11 (181)
                      .|+.|+.
T Consensus        54 ~C~~C~G   60 (111)
T PLN03165         54 VCRFCVG   60 (111)
T ss_pred             CCCCCcC
Confidence            4666665


No 393
>KOG0653 consensus Cyclin B and related kinase-activating proteins [Cell cycle control, cell division, chromosome partitioning]
Probab=20.37  E-value=4.5e+02  Score=23.24  Aligned_cols=65  Identities=12%  Similarity=0.127  Sum_probs=33.8

Q ss_pred             HHHHHHHHHHHHHhCCchHHHHH--HHHHHHHhh--h---CHHHHHHHHHH-HHHHhCCCCccccChhhheec
Q 030241          106 ILAFKTIATMSDRIGQMRYIRRW--KIKSLVEAE--I---KTHYWLLACTL-LVDKKTSHALLRVQPKILLTS  170 (181)
Q Consensus       106 ~~a~~~I~~ia~~L~Lp~~v~e~--~i~k~a~~~--l---~~~~v~AAclY-iACR~~~~p~t~~~~~~~~~~  170 (181)
                      ..-.+.+-++-.+++|.....=-  .|+......  +   +...+.++||+ |||+.+...+..++=-++.+.
T Consensus       159 ~iLvdwlvevh~~F~L~~ETL~LaVnliDRfL~~~~v~~~~lqLvgvsalf~IA~K~EE~~~P~v~dlv~isd  231 (391)
T KOG0653|consen  159 AILVDWLVEVHEKFGLSPETLYLAVNLIDRFLSKVKVPLKKLQLVGVSALLSIACKYEEISLPSVEDLVLITD  231 (391)
T ss_pred             HHHHHHHHHhhhhcCcCHHHHHHHHHHHHHHHHHhcccHHHhhHHhHHHHHHHHHhhhhccCCccceeEeeeC
Confidence            34555666777777776432111  233222211  1   55666677755 999976554444433333333


No 394
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=20.18  E-value=52  Score=22.01  Aligned_cols=20  Identities=25%  Similarity=0.614  Sum_probs=10.0

Q ss_pred             eeEeCCCCceEeCCCccccc
Q 030241           15 VVFDHSAGDTVCSECGLVLE   34 (181)
Q Consensus        15 iv~D~~~G~~vC~~CG~Vl~   34 (181)
                      +-.+++--..+|..||.++-
T Consensus        38 ~~l~~~~kr~~Ck~C~~~li   57 (85)
T PF04032_consen   38 IRLPPEIKRTICKKCGSLLI   57 (85)
T ss_dssp             ---STTCCCTB-TTT--B--
T ss_pred             CCCChHHhcccccCCCCEEe
Confidence            34566677889999999984


No 395
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=20.09  E-value=88  Score=23.64  Aligned_cols=24  Identities=29%  Similarity=0.758  Sum_probs=16.6

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCcccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLVL   33 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~Vl   33 (181)
                      .+|+.||+   +.+-   -...|..||.-.
T Consensus        30 ~kC~~CG~---v~~P---Pr~~Cp~C~~~~   53 (140)
T COG1545          30 TKCKKCGR---VYFP---PRAYCPKCGSET   53 (140)
T ss_pred             EEcCCCCe---EEcC---CcccCCCCCCCC
Confidence            57999996   2332   247899998764


No 396
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=20.07  E-value=49  Score=17.08  Aligned_cols=11  Identities=36%  Similarity=0.969  Sum_probs=7.7

Q ss_pred             CceEeCCCccc
Q 030241           22 GDTVCSECGLV   32 (181)
Q Consensus        22 G~~vC~~CG~V   32 (181)
                      |+..|..|+.+
T Consensus         1 g~W~C~~C~~~   11 (26)
T smart00547        1 GDWECPACTFL   11 (26)
T ss_pred             CcccCCCCCCc
Confidence            56678888765


No 397
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms]
Probab=20.06  E-value=52  Score=30.62  Aligned_cols=29  Identities=28%  Similarity=0.596  Sum_probs=20.1

Q ss_pred             CCCCCCCCCCceeEeCCCCceEeCCCccc
Q 030241            4 AFCSDCKKHTEVVFDHSAGDTVCSECGLV   32 (181)
Q Consensus         4 ~~Cp~Cg~~~~iv~D~~~G~~vC~~CG~V   32 (181)
                      ..|-+||.+..--..-.+|..+|.+|=.|
T Consensus         9 evC~DC~~~dp~WASvnrGt~lC~eCcsv   37 (669)
T KOG0818|consen    9 EVCADCSGPDPSWASVNRGTFLCDECCSV   37 (669)
T ss_pred             hhhcccCCCCCcceeecCceEehHhhhHH
Confidence            45899987422223347899999999776


No 398
>PF04967 HTH_10:  HTH DNA binding domain;  InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif. This entry represents the HTH DNA binding domain found in Halobacterium salinarium (Halobacterium halobium) and described as a putative bacterio-opsin activator. 
Probab=20.02  E-value=1.9e+02  Score=18.21  Aligned_cols=18  Identities=11%  Similarity=0.224  Sum_probs=14.0

Q ss_pred             HHHHHHHHhCCchHHHHH
Q 030241          111 TIATMSDRIGQMRYIRRW  128 (181)
Q Consensus       111 ~I~~ia~~L~Lp~~v~e~  128 (181)
                      .+.++|+.||++++....
T Consensus        25 tl~elA~~lgis~st~~~   42 (53)
T PF04967_consen   25 TLEELAEELGISKSTVSE   42 (53)
T ss_pred             CHHHHHHHhCCCHHHHHH
Confidence            578899999999875444


Done!