Citrus Sinensis ID: 030242

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180

MFKKFSAEEVSAQNQVKASVQRKIRQSIADEYPGLEPVLDDLLPKKSPLIVAKCQNHLNLVLVNNVPLFFNIRDGPYMPTLRLLHQYPNIMKKLQVDRGAIKFVLSGANIMCPGLTSPGGSLDEEVGAETPVAIMAEGKQHALAIGFTKMSAKDIKAINKGIGVDNMHYLNDGLWKVSWI

cccccccccccccccccHHHHHHHHHHHHHHccccccHHcccccccccEEEEEEEccEEEEEEccEEEEEEEcccccccEEEEcccccccccEEEEcccHHHHHccccccccccCCccccccccccccccEEEEEEcccccEEEEEEEEccHHHHHHcccccCEEEEEECcccccccccc

*FKK*********************QSIADEYPGLEPVLDDLLPKKSPLIVAKCQNHLNLVLVNNVPLFFNIRDGPYMPTLRLLHQYPNIMKKLQVDRGAIKFVLSGANIMCPGLTSPGGSLDEEVGAETPVAIMAEGKQHALAIGFTKMSAKDIKAINKGIGVDNMHYLNDGLWKVSWI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFKKFSAEEVSAQNQVKASVQRKIRQSIADEYPGLEPVLDDLLPKKSPLIVAKCQNHLNLVLVNNVPLFFNIRDGPYMPTLRLLHQYPNIMKKLQVDRGAIKFVLSGANIMCPGLTSPGGSLDEEVGAETPVAIMAEGKQHALAIGFTKMSAKDIKAINKGIGVDNMHYLNDGLWKVSWI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Malignant T-cell-amplified sequence 1 homolog	May play a role in cell cycle regulation. May play a role as translation enhancer by binding to the cap complex of the 5'-terminus of mRNAs.	probable	Q86KL4
Malignant T-cell-amplified sequence 1	Plays a role as translation enhancer and involved in cell cycle regulation.	probable	Q5ZI42
Malignant T-cell-amplified sequence 1	Plays a role as translation enhancer and involved in cell cycle regulation.	probable	Q6DER1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3R90, chain A
Confidence level:very confident
Coverage over the Query: 1-178
View the alignment between query and template
View the model in PyMOL