BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 030249
(180 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|P0CB19|Y3081_ARATH Uncharacterized protein At3g50808 OS=Arabidopsis thaliana
GN=At3g50808 PE=4 SV=1
Length = 110
Score = 34.7 bits (78), Expect = 0.35, Method: Compositional matrix adjust.
Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 5/66 (7%)
Query: 83 IQKFIDISCVQTYIINSAKIVFLNERP---QPRPGKGVTNTCEICCRSL--LDSFRFCSL 137
+ +++DIS + Y IN IV++N+R R V + C+IC + S FCS+
Sbjct: 1 MSQYMDISGIHLYSINGFPIVYINQRRGNNNHRSRSNVMHKCKICEWEIDAASSALFCSM 60
Query: 138 GCKVTS 143
CK S
Sbjct: 61 ECKFRS 66
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.331 0.142 0.481
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 66,183,040
Number of Sequences: 539616
Number of extensions: 2466526
Number of successful extensions: 5930
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 5930
Number of HSP's gapped (non-prelim): 1
length of query: 180
length of database: 191,569,459
effective HSP length: 110
effective length of query: 70
effective length of database: 132,211,699
effective search space: 9254818930
effective search space used: 9254818930
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 57 (26.6 bits)