BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030249
         (180 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|P0CB19|Y3081_ARATH Uncharacterized protein At3g50808 OS=Arabidopsis thaliana
           GN=At3g50808 PE=4 SV=1
          Length = 110

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 83  IQKFIDISCVQTYIINSAKIVFLNERP---QPRPGKGVTNTCEICCRSL--LDSFRFCSL 137
           + +++DIS +  Y IN   IV++N+R      R    V + C+IC   +    S  FCS+
Sbjct: 1   MSQYMDISGIHLYSINGFPIVYINQRRGNNNHRSRSNVMHKCKICEWEIDAASSALFCSM 60

Query: 138 GCKVTS 143
            CK  S
Sbjct: 61  ECKFRS 66


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.331    0.142    0.481 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 66,183,040
Number of Sequences: 539616
Number of extensions: 2466526
Number of successful extensions: 5930
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 5930
Number of HSP's gapped (non-prelim): 1
length of query: 180
length of database: 191,569,459
effective HSP length: 110
effective length of query: 70
effective length of database: 132,211,699
effective search space: 9254818930
effective search space used: 9254818930
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 57 (26.6 bits)