Query         030263
Match_columns 180
No_of_seqs    221 out of 446
Neff          5.7 
Searched_HMMs 46136
Date          Fri Mar 29 11:04:54 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030263.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030263hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3288 OTU-like cysteine prot 100.0 1.1E-30 2.3E-35  221.7   4.1  106   74-179   139-263 (307)
  2 KOG3288 OTU-like cysteine prot  99.9 4.3E-24 9.3E-29  181.6   5.3   86    1-93    219-304 (307)
  3 KOG2606 OTU (ovarian tumor)-li  99.6 2.8E-15   6E-20  129.9   5.2   70   75-145   191-269 (302)
  4 COG5539 Predicted cysteine pro  99.4 4.6E-14   1E-18  122.1   1.6   72   74-145   138-210 (306)
  5 COG5539 Predicted cysteine pro  99.0 1.1E-10 2.5E-15  101.2   2.5   85    2-93    219-303 (306)
  6 PF02338 OTU:  OTU-like cystein  99.0 4.7E-10   1E-14   84.0   3.4   63   74-143    27-90  (121)
  7 PF10275 Peptidase_C65:  Peptid  97.0   0.002 4.3E-08   54.4   6.2   65   74-138   140-208 (244)
  8 KOG3991 Uncharacterized conser  95.7   0.016 3.6E-07   49.5   4.5   71   75-145   158-230 (256)
  9 KOG2605 OTU (ovarian tumor)-li  80.3       2 4.4E-05   39.2   3.7   51   75-126   247-297 (371)
 10 PF01188 MR_MLE:  Mandelate rac  40.7      28  0.0006   23.2   2.4   32  100-132    35-66  (67)
 11 PHA00616 hypothetical protein   35.1      26 0.00057   22.5   1.5   30   66-96      3-32  (44)
 12 TIGR02934 nifT_nitrog probable  33.0      12 0.00025   26.3  -0.4   22   98-119    20-41  (67)
 13 KOG2586 Pyridoxamine-phosphate  32.4      31 0.00067   29.4   1.9   37   70-116   153-189 (228)
 14 PRK05111 acetylornithine deace  30.2      55  0.0012   28.5   3.2   13    2-15     74-86  (383)
 15 PRK13007 succinyl-diaminopimel  29.7      99  0.0021   26.5   4.7   48    2-52     64-111 (352)
 16 PF06679 DUF1180:  Protein of u  29.6      44 0.00096   27.2   2.3   21  146-166   141-161 (163)
 17 PF06988 NifT:  NifT/FixU prote  28.7     2.7 5.8E-05   29.2  -4.2   22   98-119    20-41  (64)
 18 PRK13009 succinyl-diaminopimel  27.8 3.3E+02  0.0072   23.5   7.7   13    2-15     61-73  (375)
 19 cd00022 BIR Baculoviral inhibi  27.1      28 0.00061   23.2   0.7   28   54-82     25-52  (69)
 20 cd00814 MetRS_core catalytic c  26.8 1.5E+02  0.0033   25.7   5.4   31   42-72     99-129 (319)
 21 PF07967 zf-C3HC:  C3HC zinc fi  25.4      25 0.00055   26.9   0.2   24   54-77     33-56  (133)
 22 KOG1247 Methionyl-tRNA synthet  25.4      44 0.00095   31.7   1.7   62    4-75     86-147 (567)
 23 TIGR01902 dapE-lys-deAc N-acet  24.9 1.2E+02  0.0027   25.9   4.4   25    2-30     53-77  (336)
 24 PF05129 Elf1:  Transcription e  24.8      48  0.0011   23.7   1.6   33   60-107    42-74  (81)
 25 COG4604 CeuD ABC-type enteroch  24.6      63  0.0014   27.9   2.4   28  116-143   223-250 (252)
 26 PRK06915 acetylornithine deace  24.1 1.2E+02  0.0027   26.9   4.4   13    2-15     96-108 (422)
 27 PF05415 Peptidase_C36:  Beet n  23.6      72  0.0016   23.9   2.3   32   99-133    35-68  (104)
 28 TIGR01246 dapE_proteo succinyl  23.5 4.4E+02  0.0096   22.7   7.7   13    2-15     58-70  (370)
 29 COG3426 Butyrate kinase [Energ  22.2      59  0.0013   29.4   1.9   25  100-124   316-340 (358)
 30 smart00238 BIR Baculoviral inh  21.7      42 0.00091   22.4   0.7   32   53-85     26-57  (71)
 31 PRK12301 bssS biofilm formatio  21.1      74  0.0016   23.2   1.9   36    9-53     24-66  (84)
 32 COG5554 NifU Nitrogen fixation  20.8      16 0.00035   25.3  -1.5   21   98-118    19-39  (69)
 33 PRK10963 hypothetical protein;  20.7      87  0.0019   26.1   2.5   37   77-119     5-41  (223)
 34 cd02426 Pol_gamma_b_Cterm C-te  20.7 1.9E+02   0.004   22.0   4.2   31   24-56     28-58  (128)
 35 PF00096 zf-C2H2:  Zinc finger,  20.0      95  0.0021   15.9   1.8   17   66-82      2-18  (23)

No 1  
>KOG3288 consensus OTU-like cysteine protease [Signal transduction mechanisms; Posttranslational modification, protein turnover, chaperones]
Probab=99.96  E-value=1.1e-30  Score=221.74  Aligned_cols=106  Identities=44%  Similarity=0.728  Sum_probs=94.6

Q ss_pred             cchhHHHHHHHHhccccccccccCCChHHHHHhcCCCCCcccHHHHHHHHhHhCceEEEEEcCCCceeeeec--------
Q 030263           74 VIGQKAIAATVASDTVKHSEAFIGKSNQDYCSWIQDPEKWGGAIELSILADYYGSEIAAYDIQTTRCDLYGQ--------  145 (180)
Q Consensus        74 l~lr~~vA~~I~~~p~~y~~~~L~~~~~eYc~~I~~~~~WGG~IEL~iLS~~~~~~I~v~d~~~~~~~~fge--------  145 (180)
                      .+||+++|+.+++||+.||+|+|||++.|||.||++.++|||+|||+|||++|+++|+|+|++++|+++|||        
T Consensus       139 ~elR~iiA~~Vasnp~~yn~AiLgK~n~eYc~WI~k~dsWGGaIElsILS~~ygveI~vvDiqt~rid~fged~~~~~rv  218 (307)
T KOG3288|consen  139 YELREIIAQEVASNPDKYNDAILGKPNKEYCAWILKMDSWGGAIELSILSDYYGVEICVVDIQTVRIDRFGEDKNFDNRV  218 (307)
T ss_pred             HHHHHHHHHHHhcChhhhhHHHhCCCcHHHHHHHccccccCceEEeeeehhhhceeEEEEecceeeehhcCCCCCCCceE
Confidence            479999999999999999999999999999999999999999999999999999999999999999999999        


Q ss_pred             -----------ccCCCCCCCCCCeeeeeCCCCCChhHHHHHHhhh
Q 030263          146 -----------ISAFEGAPVEFDQSSVPVRKDRTIGPAEELAFET  179 (180)
Q Consensus       146 -----------~~~~~~~~~~~d~t~f~~~d~~~~~~~l~~a~~l  179 (180)
                                 +....-.|.+.|.|+||.+|+.++..++++|.+|
T Consensus       219 ~llydGIHYD~l~m~~~~~~~~~~tifp~~dd~v~~~alqLa~~~  263 (307)
T KOG3288|consen  219 LLLYDGIHYDPLAMNEFKPTDVDNTIFPVSDDTVLTQALQLASEL  263 (307)
T ss_pred             EEEecccccChhhhccCCccCCcccccccccchHHHHHHHHHHHH
Confidence                       1111225678899999999987777788877764


No 2  
>KOG3288 consensus OTU-like cysteine protease [Signal transduction mechanisms; Posttranslational modification, protein turnover, chaperones]
Probab=99.89  E-value=4.3e-24  Score=181.59  Aligned_cols=86  Identities=47%  Similarity=0.746  Sum_probs=77.1

Q ss_pred             CeeecccccceeeccCCCCCCCCCCeeeeeCCCCCccchHHHHHHHHHHHHHhcCCCcccccceeeecccccccchhHHH
Q 030263            1 MLIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLCYGVCQIGVIGQKAI   80 (180)
Q Consensus         1 ~liYsGIHYD~l~l~~~~~~~~~~d~t~F~~~d~~~l~~~~~~A~~L~~~lk~~~~~Tdt~~F~l~C~~C~~~l~lr~~v   80 (180)
                      +|||||||||+|++++.  .|.+.|-|+||.+|+.+    +..|++||+++|++||||||++|+|||++|+.++.|++.+
T Consensus       219 ~llydGIHYD~l~m~~~--~~~~~~~tifp~~dd~v----~~~alqLa~~~k~~r~ytdt~~ftlRC~~Cq~glvGq~ea  292 (307)
T KOG3288|consen  219 LLLYDGIHYDPLAMNEF--KPTDVDNTIFPVSDDTV----LTQALQLASELKRTRYYTDTAKFTLRCMVCQMGLVGQKEA  292 (307)
T ss_pred             EEEecccccChhhhccC--CccCCcccccccccchH----HHHHHHHHHHHHhcceeccccceEEEeeecccceeeHHHH
Confidence            58999999999999976  56778999999999755    4899999999999999999999999999999999999755


Q ss_pred             HHHHHhccccccc
Q 030263           81 AATVASDTVKHSE   93 (180)
Q Consensus        81 A~~I~~~p~~y~~   93 (180)
                      + .|+..++|-|-
T Consensus       293 ~-eHA~~TGH~nF  304 (307)
T KOG3288|consen  293 A-EHAKATGHVNF  304 (307)
T ss_pred             H-HHHHhcCCCcc
Confidence            5 49999999763


No 3  
>KOG2606 consensus OTU (ovarian tumor)-like cysteine protease [Signal transduction mechanisms; Posttranslational modification, protein turnover, chaperones]
Probab=99.56  E-value=2.8e-15  Score=129.85  Aligned_cols=70  Identities=20%  Similarity=0.349  Sum_probs=64.5

Q ss_pred             chhHHHHHHHHhccccccccccC------C---ChHHHHHhcCCCCCcccHHHHHHHHhHhCceEEEEEcCCCceeeeec
Q 030263           75 IGQKAIAATVASDTVKHSEAFIG------K---SNQDYCSWIQDPEKWGGAIELSILADYYGSEIAAYDIQTTRCDLYGQ  145 (180)
Q Consensus        75 ~lr~~vA~~I~~~p~~y~~~~L~------~---~~~eYc~~I~~~~~WGG~IEL~iLS~~~~~~I~v~d~~~~~~~~fge  145 (180)
                      .||...|+|+++|-++|-|+++.      .   ++++||+.|++|..|||+|||.|||+.|++||.||+.. +.+..|||
T Consensus       191 kLR~~~a~Ymr~H~~df~pf~~~eet~d~~~~~~f~~Yc~eI~~t~~WGgelEL~AlShvL~~PI~Vy~~~-~p~~~~ge  269 (302)
T KOG2606|consen  191 KLREETADYMREHVEDFLPFLLDEETGDSLGPEDFDKYCREIRNTAAWGGELELKALSHVLQVPIEVYQAD-GPILEYGE  269 (302)
T ss_pred             HHHHHHHHHHHHHHHHhhhHhcCccccccCCHHHHHHHHHHhhhhccccchHHHHHHHHhhccCeEEeecC-CCceeech
Confidence            79999999999999999997763      2   39999999999999999999999999999999999975 66999997


No 4  
>COG5539 Predicted cysteine protease (OTU family) [Posttranslational modification, protein turnover, chaperones]
Probab=99.41  E-value=4.6e-14  Score=122.11  Aligned_cols=72  Identities=24%  Similarity=0.399  Sum_probs=70.1

Q ss_pred             cchhHHHHHHHHhccccccccccCCChHHHHHhcCCCCCcc-cHHHHHHHHhHhCceEEEEEcCCCceeeeec
Q 030263           74 VIGQKAIAATVASDTVKHSEAFIGKSNQDYCSWIQDPEKWG-GAIELSILADYYGSEIAAYDIQTTRCDLYGQ  145 (180)
Q Consensus        74 l~lr~~vA~~I~~~p~~y~~~~L~~~~~eYc~~I~~~~~WG-G~IEL~iLS~~~~~~I~v~d~~~~~~~~fge  145 (180)
                      -+||.+++..+.++|+.|++++++.|.-+||.||.++++|| |.||+.|||+.|+++|+|+|+..++.++||+
T Consensus       138 ~~lrE~vs~Ev~snPDl~n~~i~~~~~i~y~~~i~k~d~~~dG~ieia~iS~~l~v~i~~Vdv~~~~~dr~~~  210 (306)
T COG5539         138 AKLREVVSLEVLSNPDLYNPAILEIDVIAYATWIVKPDSQGDGCIEIAIISDQLPVRIHVVDVDKDSEDRYNS  210 (306)
T ss_pred             HHHHHHHHHHHhhCccccchhhcCcchHHHHHhhhccccCCCceEEEeEeccccceeeeeeecchhHHhhccC
Confidence            47999999999999999999999999999999999999999 9999999999999999999999899999998


No 5  
>COG5539 Predicted cysteine protease (OTU family) [Posttranslational modification, protein turnover, chaperones]
Probab=99.02  E-value=1.1e-10  Score=101.21  Aligned_cols=85  Identities=20%  Similarity=0.310  Sum_probs=65.6

Q ss_pred             eeecccccceeeccCCCCCCCCCCeeeeeCCCCCccchHHHHHHHHHHHHHhcCCCcccccceeeecccccccchhHHHH
Q 030263            2 LIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLCYGVCQIGVIGQKAIA   81 (180)
Q Consensus         2 liYsGIHYD~l~l~~~~~~~~~~d~t~F~~~d~~~l~~~~~~A~~L~~~lk~~~~~Tdt~~F~l~C~~C~~~l~lr~~vA   81 (180)
                      ++|+|||||..++...+- ...++.-.|+.++-     +.-.+++||+-|+..+|+|||+++.++|+.||.+++|.+.+.
T Consensus       219 i~f~g~hfD~~t~~m~~~-dt~~ne~~~~a~~g-----~~~ei~qLas~lk~~~~~~nT~~~~ik~n~c~~~~~~e~~~~  292 (306)
T COG5539         219 ILFTGIHFDEETLAMVLW-DTYVNEVLFDASDG-----ITIEIQQLASLLKNPHYYTNTASPSIKCNICGTGFVGEKDYY  292 (306)
T ss_pred             hhhcccccchhhhhcchH-HHHHhhhccccccc-----chHHHHHHHHHhcCceEEeecCCceEEeeccccccchhhHHH
Confidence            479999999998653220 11123344444443     236899999999999999999999999999999999997555


Q ss_pred             HHHHhccccccc
Q 030263           82 ATVASDTVKHSE   93 (180)
Q Consensus        82 ~~I~~~p~~y~~   93 (180)
                      + |+--+||||-
T Consensus       293 ~-Ha~a~GH~n~  303 (306)
T COG5539         293 A-HALATGHYNF  303 (306)
T ss_pred             H-HHHhhcCccc
Confidence            5 9999999985


No 6  
>PF02338 OTU:  OTU-like cysteine protease;  InterPro: IPR003323 This is a group of proteins found primarily in viruses, eukaryotes and in the pathogenic bacterium Chlamydia pneumoniae. In viruses they are annotated as replicase or RNA-dependent RNA polymerase. The eukaryotic sequences are related to the Ovarian Tumour (OTU) gene in Drosophila, cezanne deubiquitinating peptidase and tumor necrosis factor, alpha-induced protein 3 (MEROPS peptidase family C64) and otubain 1 and otubain 2 (MEROPS peptidase family C65).  None of these proteins has a known biochemical function but low sequence similarity with the polyprotein regions of arteriviruses, and conserved cysteine and histidine, and possibly the aspartate, residues suggests that those not yet recognised as peptidases could possess cysteine protease activity [].; PDB: 2VFJ_C 3DKB_F 3PHW_A 3PHU_B 3PHX_A 3BY4_A 3C0R_C 3PRM_C 3PRP_C 3ZRH_A ....
Probab=98.96  E-value=4.7e-10  Score=83.98  Aligned_cols=63  Identities=25%  Similarity=0.392  Sum_probs=55.9

Q ss_pred             cchhHHHHHHHH-hccccccccccCCChHHHHHhcCCCCCcccHHHHHHHHhHhCceEEEEEcCCCceeee
Q 030263           74 VIGQKAIAATVA-SDTVKHSEAFIGKSNQDYCSWIQDPEKWGGAIELSILADYYGSEIAAYDIQTTRCDLY  143 (180)
Q Consensus        74 l~lr~~vA~~I~-~~p~~y~~~~L~~~~~eYc~~I~~~~~WGG~IEL~iLS~~~~~~I~v~d~~~~~~~~f  143 (180)
                      .++|+.++++++ .+++.|.+++.+.       +++++..|||++||.|||+.|+++|.|++..+++...+
T Consensus        27 ~~lR~~~~~~l~~~~~~~~~~~~~~~-------~~~~~~~Wg~~~el~a~a~~~~~~I~v~~~~~~~~~~~   90 (121)
T PF02338_consen   27 QELRKAVVDYLRDKNRDKFEEFLEGD-------KMSKPGTWGGEIELQALANVLNRPIIVYSSSDGDNVVF   90 (121)
T ss_dssp             HHHHHHHHHHHHTHTTTHHHHHHHHH-------HHTSTTSHEEHHHHHHHHHHHTSEEEEECETTTBEEEE
T ss_pred             HHHHHHHHHHHHHhccchhhhhhhhh-------hhccccccCcHHHHHHHHHHhCCeEEEEEcCCCCccce
Confidence            489999999999 9999999966544       99999999999999999999999999998877765444


No 7  
>PF10275 Peptidase_C65:  Peptidase C65 Otubain;  InterPro: IPR019400 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].   This family of proteins is a highly specific ubiquitin iso-peptidase that removes ubiquitin from proteins. The modification of cellular proteins by ubiquitin (Ub) is an important event that underlies protein stability and function in eukaryotes, as it is a dynamic and reversible process. Otubain carries several key conserved domains: (i) the OTU (ovarian tumour domain) in which there is an active cysteine protease triad (ii) a nuclear localisation signal, (iii) a Ub interaction motif (UIM)-like motif phi-xx-A-xxxs-xx-Ac (where phi indicates an aromatic amino acid, x indicates any amino acid and Ac indicates an acidic amino acid), (iv) a Ub-associated (UBA)-like domain and (v) the LxxLL motif. ; PDB: 4DDG_C 3VON_O 2ZFY_A 4DHZ_A 4DDI_C 1TFF_A 4DHJ_I 4DHI_B.
Probab=96.96  E-value=0.002  Score=54.39  Aligned_cols=65  Identities=14%  Similarity=0.184  Sum_probs=51.2

Q ss_pred             cchhHHHHHHHHhccccccccccC---CChHHHH-HhcCCCCCcccHHHHHHHHhHhCceEEEEEcCCC
Q 030263           74 VIGQKAIAATVASDTVKHSEAFIG---KSNQDYC-SWIQDPEKWGGAIELSILADYYGSEIAAYDIQTT  138 (180)
Q Consensus        74 l~lr~~vA~~I~~~p~~y~~~~L~---~~~~eYc-~~I~~~~~WGG~IEL~iLS~~~~~~I~v~d~~~~  138 (180)
                      .-+|-..+.+++.|++.|.+++.|   .++++|| +.|+....=.+.|.+.|||++++++|.|+-...+
T Consensus       140 ~flRLlts~~l~~~~d~y~~fi~~~~~~tve~~C~~~Vep~~~Ead~v~i~ALa~aL~v~i~v~yld~~  208 (244)
T PF10275_consen  140 IFLRLLTSAYLKSNSDEYEPFIDGLEYLTVEEFCSQEVEPMGKEADHVQIIALAQALGVPIRVEYLDRS  208 (244)
T ss_dssp             HHHHHHHHHHHHHTHHHHGGGSSTT--S-HHHHHHHHTSSTT--B-HHHHHHHHHHHT--EEEEESSSS
T ss_pred             HHHHHHHHHHHHhhHHHHhhhhcccccCCHHHHHHhhcccccccchhHHHHHHHHHhCCeEEEEEecCC
Confidence            368888999999999999996666   8899999 6777777788999999999999999999877643


No 8  
>KOG3991 consensus Uncharacterized conserved protein [Function unknown]
Probab=95.67  E-value=0.016  Score=49.53  Aligned_cols=71  Identities=11%  Similarity=0.085  Sum_probs=57.7

Q ss_pred             chhHHHHHHHHhccccccccccC-CChHHHHHh-cCCCCCcccHHHHHHHHhHhCceEEEEEcCCCceeeeec
Q 030263           75 IGQKAIAATVASDTVKHSEAFIG-KSNQDYCSW-IQDPEKWGGAIELSILADYYGSEIAAYDIQTTRCDLYGQ  145 (180)
Q Consensus        75 ~lr~~vA~~I~~~p~~y~~~~L~-~~~~eYc~~-I~~~~~WGG~IEL~iLS~~~~~~I~v~d~~~~~~~~fge  145 (180)
                      -+|-..+..++++++.|-|++=| +++++||.. ++--..=-+.|+|-|||+++++.|.|..+.-+.....|.
T Consensus       158 ylRLvtS~~ik~~adfy~pFI~e~~tV~~fC~~eVEPm~kesdhi~I~ALs~Al~i~irVey~dr~~~~~~~h  230 (256)
T KOG3991|consen  158 YLRLVTSGFIKSNADFYQPFIDEGMTVKAFCTQEVEPMYKESDHIHITALSQALGIRIRVEYVDRGSGDTVNH  230 (256)
T ss_pred             HHHHHHHHHHhhChhhhhccCCCCCcHHHHHHhhcchhhhccCceeHHHHHhhhCceEEEEEecCCCCCCCCC
Confidence            58888999999999999996665 899999975 444444578999999999999999999876555555553


No 9  
>KOG2605 consensus OTU (ovarian tumor)-like cysteine protease [Signal transduction mechanisms; Posttranslational modification, protein turnover, chaperones]
Probab=80.34  E-value=2  Score=39.17  Aligned_cols=51  Identities=14%  Similarity=0.194  Sum_probs=45.4

Q ss_pred             chhHHHHHHHHhccccccccccCCChHHHHHhcCCCCCcccHHHHHHHHhHh
Q 030263           75 IGQKAIAATVASDTVKHSEAFIGKSNQDYCSWIQDPEKWGGAIELSILADYY  126 (180)
Q Consensus        75 ~lr~~vA~~I~~~p~~y~~~~L~~~~~eYc~~I~~~~~WGG~IEL~iLS~~~  126 (180)
                      .-|+++.++...+.++|+. +.-+.+..|.+.-+....||-.||+++.|..+
T Consensus       247 ~~~~~~~dq~~~e~~~~~~-~vt~~~~~y~k~kr~~~~~gnhie~Qa~a~~~  297 (371)
T KOG2605|consen  247 HNRRECVDQLKKERDFYED-YVTEDFTSYIKRKRADGEPGNHIEQQAAADIY  297 (371)
T ss_pred             HHHHHHHHHHhhccccccc-ccccchhhcccccccCCCCcchHHHhhhhhhh
Confidence            5677888989889999988 66789999999999999999999999999733


No 10 
>PF01188 MR_MLE:  Mandelate racemase / muconate lactonizing enzyme, C-terminal domain;  InterPro: IPR013342 Mandelate racemase 5.1.2.2 from EC (MR) and muconate lactonising enzyme 5.5.1.1 from EC (MLE) are two bacterial enzymes involved in aromatic acid catabolism. They catalyse mechanistically distinct reactions yet they are related at the level of their primary, quaternary (homooctamer) and tertiary structures [, ]. A number of other proteins also seem to be evolutionary related to these two enzymes. These include, various plasmid-encoded chloromuconate cycloisomerases 5.5.1.7 from EC, Escherichia coli protein rspA [], E. coli bifunctional DGOA protein, E. coli hypothetical proteins ycjG, yfaW and yidU and a hypothetical protein from Streptomyces ambofaciens []. This entry represents the C-terminal region of these proteins.; PDB: 3QLD_B 3CYJ_C 2QDD_B 3FVD_A 3H7V_A 2OZT_A 3NXL_A 1JDF_D 1JCT_B 1EC9_C ....
Probab=40.67  E-value=28  Score=23.24  Aligned_cols=32  Identities=31%  Similarity=0.401  Sum_probs=24.7

Q ss_pred             hHHHHHhcCCCCCcccHHHHHHHHhHhCceEEE
Q 030263          100 NQDYCSWIQDPEKWGGAIELSILADYYGSEIAA  132 (180)
Q Consensus       100 ~~eYc~~I~~~~~WGG~IEL~iLS~~~~~~I~v  132 (180)
                      .++| .||+.|-....--++..|++...+||++
T Consensus        35 l~~~-~~iEeP~~~~d~~~~~~l~~~~~~pia~   66 (67)
T PF01188_consen   35 LEDY-EWIEEPLPPDDLDGLAELRQQTSVPIAA   66 (67)
T ss_dssp             HGGG-SEEESSSSTTSHHHHHHHHHHCSSEEEE
T ss_pred             cChh-heeecCCCCCCHHHHHHHHHhCCCCEEe
Confidence            3445 7888777777778888999999999974


No 11 
>PHA00616 hypothetical protein
Probab=35.05  E-value=26  Score=22.52  Aligned_cols=30  Identities=10%  Similarity=-0.037  Sum_probs=22.8

Q ss_pred             eecccccccchhHHHHHHHHhcccccccccc
Q 030263           66 CYGVCQIGVIGQKAIAATVASDTVKHSEAFI   96 (180)
Q Consensus        66 ~C~~C~~~l~lr~~vA~~I~~~p~~y~~~~L   96 (180)
                      +|.-||..+.-.+....-++.++++ +++.+
T Consensus         3 qC~~CG~~F~~~s~l~~H~r~~hg~-~~~~~   32 (44)
T PHA00616          3 QCLRCGGIFRKKKEVIEHLLSVHKQ-NKLTL   32 (44)
T ss_pred             ccchhhHHHhhHHHHHHHHHHhcCC-Cccce
Confidence            6999999987777777778888777 55443


No 12 
>TIGR02934 nifT_nitrog probable nitrogen fixation protein FixT. This largely uncharacterized protein family is assigned a role in nitrogen fixation by two criteria. First, its gene occurs, generally, among genes essential for expression of active nitrogenase. Second, its phylogenetic profile closely matches that of nitrogen-fixing bacteria. However, mutational studies in Klebsiella pneumoniae failed to demonstrate any phenotype for deletion or overexpression of the protein.
Probab=33.02  E-value=12  Score=26.29  Aligned_cols=22  Identities=27%  Similarity=0.542  Sum_probs=17.9

Q ss_pred             CChHHHHHhcCCCCCcccHHHH
Q 030263           98 KSNQDYCSWIQDPEKWGGAIEL  119 (180)
Q Consensus        98 ~~~~eYc~~I~~~~~WGG~IEL  119 (180)
                      ++.+|=+-.++++..|||.+-|
T Consensus        20 KDLEE~Vv~~e~~~~WGG~v~L   41 (67)
T TIGR02934        20 KDLEEVIVSVEKEELWGGWVTL   41 (67)
T ss_pred             CcchhheeeeecCccccCEEEE
Confidence            6788888889999999996533


No 13 
>KOG2586 consensus Pyridoxamine-phosphate oxidase [Coenzyme transport and metabolism]
Probab=32.38  E-value=31  Score=29.41  Aligned_cols=37  Identities=16%  Similarity=0.265  Sum_probs=21.2

Q ss_pred             cccccchhHHHHHHHHhccccccccccCCChHHHHHhcCCCCCcccH
Q 030263           70 CQIGVIGQKAIAATVASDTVKHSEAFIGKSNQDYCSWIQDPEKWGGA  116 (180)
Q Consensus        70 C~~~l~lr~~vA~~I~~~p~~y~~~~L~~~~~eYc~~I~~~~~WGG~  116 (180)
                      |+.....|..-+..-.+.+++|-..          +-|..|++|||-
T Consensus       153 qs~vI~~re~l~k~~e~l~~~~~~~----------~~IpkP~swgg~  189 (228)
T KOG2586|consen  153 QSEVIPDREELEKKDEELTELFGDE----------QSIPKPDSWGGY  189 (228)
T ss_pred             CCCccCCHHHHHHHHHHHHHHhccc----------ccccCCCcccce
Confidence            3334455554444444444444431          468889999993


No 14 
>PRK05111 acetylornithine deacetylase; Provisional
Probab=30.16  E-value=55  Score=28.52  Aligned_cols=13  Identities=31%  Similarity=0.669  Sum_probs=9.7

Q ss_pred             eeecccccceeecc
Q 030263            2 LIYDGLHYDALAIS   15 (180)
Q Consensus         2 liYsGIHYD~l~l~   15 (180)
                      |++.| |||+++..
T Consensus        74 il~~~-H~Dvvp~~   86 (383)
T PRK05111         74 LLLAG-HTDTVPFD   86 (383)
T ss_pred             EEEEe-eeceecCC
Confidence            45666 99999764


No 15 
>PRK13007 succinyl-diaminopimelate desuccinylase; Reviewed
Probab=29.71  E-value=99  Score=26.53  Aligned_cols=48  Identities=10%  Similarity=0.221  Sum_probs=24.4

Q ss_pred             eeecccccceeeccCCCCCCCCCCeeeeeCCCCCccchHHHHHHHHHHHHH
Q 030263            2 LIYDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQ   52 (180)
Q Consensus         2 liYsGIHYD~l~l~~~~~~~~~~d~t~F~~~d~~~l~~~~~~A~~L~~~lk   52 (180)
                      |+++| |||+++... +-.+...|-.++-..-.+. ...+..++.+++.++
T Consensus        64 i~l~~-H~Dtvp~~~-~~~~~~~~g~i~GrG~~D~-Kg~~a~~l~a~~~l~  111 (352)
T PRK13007         64 VVLAG-HLDTVPVAD-NLPSRREGDRLYGCGASDM-KSGLAVMLHLAATLA  111 (352)
T ss_pred             EEEEc-cccccCCCC-CCCcceeCCEEEccCcccc-cHHHHHHHHHHHHhh
Confidence            56777 999998652 1112233556775322111 122345555555563


No 16 
>PF06679 DUF1180:  Protein of unknown function (DUF1180);  InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown.
Probab=29.59  E-value=44  Score=27.16  Aligned_cols=21  Identities=10%  Similarity=0.156  Sum_probs=16.1

Q ss_pred             ccCCCCCCCCCCeeeeeCCCC
Q 030263          146 ISAFEGAPVEFDQSSVPVRKD  166 (180)
Q Consensus       146 ~~~~~~~~~~~d~t~f~~~d~  166 (180)
                      +.|.....+|+|.|||+.+-.
T Consensus       141 m~pL~~ddedeD~TvFd~~~~  161 (163)
T PF06679_consen  141 MAPLEEDDEDEDSTVFDANHP  161 (163)
T ss_pred             ecccCCCccccccceeeeccc
Confidence            667766677889999987653


No 17 
>PF06988 NifT:  NifT/FixU protein;  InterPro: IPR009727 This family consists of several NifT and FixU bacterial proteins. The function of NifT is unknown although it is thought that the protein may be involved in biosynthesis of the FeMo cofactor of nitrogenase although perturbation of nifT expression in Klebsiella pneumoniae has only a limited effect on nitrogen fixation [].; GO: 0009399 nitrogen fixation; PDB: 2JN4_A.
Probab=28.73  E-value=2.7  Score=29.25  Aligned_cols=22  Identities=32%  Similarity=0.696  Sum_probs=15.9

Q ss_pred             CChHHHHHhcCCCCCcccHHHH
Q 030263           98 KSNQDYCSWIQDPEKWGGAIEL  119 (180)
Q Consensus        98 ~~~~eYc~~I~~~~~WGG~IEL  119 (180)
                      ++.+|=+-.++++..|||.+.|
T Consensus        20 KDLEE~Vv~~E~~~~wGG~v~L   41 (64)
T PF06988_consen   20 KDLEEPVVSMEKPELWGGEVTL   41 (64)
T ss_dssp             TTEEEEEEEESSSSS-SSEEEE
T ss_pred             CccccceeeeeccCccCCEEEE
Confidence            5666666778899999997655


No 18 
>PRK13009 succinyl-diaminopimelate desuccinylase; Reviewed
Probab=27.79  E-value=3.3e+02  Score=23.47  Aligned_cols=13  Identities=31%  Similarity=0.593  Sum_probs=9.4

Q ss_pred             eeecccccceeecc
Q 030263            2 LIYDGLHYDALAIS   15 (180)
Q Consensus         2 liYsGIHYD~l~l~   15 (180)
                      |++.| |+|+++..
T Consensus        61 i~l~~-H~D~Vp~g   73 (375)
T PRK13009         61 LCFAG-HTDVVPPG   73 (375)
T ss_pred             EEEEe-ecccCCCC
Confidence            45666 99999653


No 19 
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins. In higher eukaryotes, BIR domains inhibit apoptosis by acting as direct inhibitors of the caspase family of protease enzymes. In yeast, BIR domains are involved in regulating cytokinesis. This novel fold is stabilized by zinc tetrahedrally coordinated by one histidine and three cysteine residues and resembles a classical zinc finger.
Probab=27.05  E-value=28  Score=23.15  Aligned_cols=28  Identities=11%  Similarity=-0.005  Sum_probs=18.1

Q ss_pred             cCCCcccccceeeecccccccchhHHHHH
Q 030263           54 KKTYTDTANFTLCYGVCQIGVIGQKAIAA   82 (180)
Q Consensus        54 ~~~~Tdt~~F~l~C~~C~~~l~lr~~vA~   82 (180)
                      -=||+.+ +..++|..|+..+...+...+
T Consensus        25 Gfyy~~~-~d~v~C~~C~~~~~~w~~~d~   52 (69)
T cd00022          25 GFYYTGR-GDEVKCFFCGLELKNWEPGDD   52 (69)
T ss_pred             CCeEcCC-CCEEEeCCCCCCccCCCCCCC
Confidence            3344433 567999999988876543333


No 20 
>cd00814 MetRS_core catalytic core domain of methioninyl-tRNA synthetases. Methionine tRNA synthetase (MetRS) catalytic core domain. This class I enzyme aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. MetRS, which consists of the core domain and an anti-codon binding domain, functions as a monomer. However, in some species the anti-codon binding domain is followed by an EMAP domain. In this case, MetRS functions as a homodimer. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.  As a result of a deletion event, MetRS has a significantly shorter core domain insertion than IleRS, ValRS, and LeuR.  Consequently, the MetRS insertion lacks the editing function.
Probab=26.83  E-value=1.5e+02  Score=25.69  Aligned_cols=31  Identities=10%  Similarity=0.096  Sum_probs=21.0

Q ss_pred             HHHHHHHHHHHhcCCCcccccceeeeccccc
Q 030263           42 DLALKLVKEQQRKKTYTDTANFTLCYGVCQI   72 (180)
Q Consensus        42 ~~A~~L~~~lk~~~~~Tdt~~F~l~C~~C~~   72 (180)
                      ..+.++.++|+++++..-...=..-|..|+.
T Consensus        99 ~~v~~i~~~L~ekG~iY~~~~~~~yc~~~~~  129 (319)
T cd00814          99 EIVQEFFKKLYENGYIYEGEYEGLYCVSCER  129 (319)
T ss_pred             HHHHHHHHHHHHCCCEEeeeeeeeECCCCCc
Confidence            5678889999999886433333446777764


No 21 
>PF07967 zf-C3HC:  C3HC zinc finger-like ;  InterPro: IPR012935 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc-finger like domain is distributed throughout the eukaryotic kingdom in NIPA (Nuclear interacting partner of ALK) and other proteins. NIPA is thought to perform an antiapoptotic role in nucleophosmin-anaplastic lymphoma kinase (ALK) mediated signalling events []. The domain is often repeated, with the second domain usually containing a large insert (approximately 90 residues) after the first three cysteine residues. The Schizosaccharomyces pombe protein containing this domain (O94506 from SWISSPROT) is involved in mRNA export from the nucleus [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=25.44  E-value=25  Score=26.88  Aligned_cols=24  Identities=8%  Similarity=0.112  Sum_probs=21.3

Q ss_pred             cCCCcccccceeeecccccccchh
Q 030263           54 KKTYTDTANFTLCYGVCQIGVIGQ   77 (180)
Q Consensus        54 ~~~~Tdt~~F~l~C~~C~~~l~lr   77 (180)
                      ++-.++++..+++|-.|+..+...
T Consensus        33 ~~GW~~~~~d~l~C~~C~~~l~~~   56 (133)
T PF07967_consen   33 RRGWICVSKDMLKCESCGARLCVK   56 (133)
T ss_pred             HcCCCcCCCCEEEeCCCCCEEEEe
Confidence            588999999999999999887666


No 22 
>KOG1247 consensus Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=25.39  E-value=44  Score=31.67  Aligned_cols=62  Identities=16%  Similarity=0.210  Sum_probs=39.0

Q ss_pred             ecccccceeeccCCCCCCCCCCeeeeeCCCCCccchHHHHHHHHHHHHHhcCCCcccccceeeecccccccc
Q 030263            4 YDGLHYDALAISPFEGAPEEFDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKTYTDTANFTLCYGVCQIGVI   75 (180)
Q Consensus         4 YsGIHYD~l~l~~~~~~~~~~d~t~F~~~d~~~l~~~~~~A~~L~~~lk~~~~~Tdt~~F~l~C~~C~~~l~   75 (180)
                      |.||||++--.--     -++|.--+-+.+..+     ..++.+-.++.+++|+.-.+-=.+.|.+|+.-|.
T Consensus        86 yh~ihk~vy~Wf~-----IdfD~fgrtTT~~qT-----~i~Q~iF~kl~~ng~~se~tv~qLyC~vc~~fla  147 (567)
T KOG1247|consen   86 YHGIHKVVYDWFK-----IDFDEFGRTTTKTQT-----EICQDIFSKLYDNGYLSEQTVKQLYCEVCDTFLA  147 (567)
T ss_pred             cchhHHHHHHhhc-----ccccccCcccCcchh-----HHHHHHhhchhhcCCcccceeeeEEehhhccccc
Confidence            7899998764421     122322222333332     4677777888888888777777788888876543


No 23 
>TIGR01902 dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine deacetylase. This clade of mainly archaeal and related bacterial species contains two characterized enzymes, an deacetylase with specificity for both N-acetyl-ornithine and N-acetyl-lysine from Thermus which is found within a lysine biosynthesis operon, and a fusion protein with acetyl-glutamate kinase (an enzyme of ornithine biosynthesis) from Lactobacillus. It is possible that all of the sequences within this clade have dual specificity, or that a mix of specificities have evolved within this clade.
Probab=24.92  E-value=1.2e+02  Score=25.95  Aligned_cols=25  Identities=12%  Similarity=0.131  Sum_probs=14.5

Q ss_pred             eeecccccceeeccCCCCCCCCCCeeeee
Q 030263            2 LIYDGLHYDALAISPFEGAPEEFDQTIFP   30 (180)
Q Consensus         2 liYsGIHYD~l~l~~~~~~~~~~d~t~F~   30 (180)
                      |+++| |||+++-   .-.+...|-.+|-
T Consensus        53 i~~~~-H~D~vp~---~~~~~~~~g~i~G   77 (336)
T TIGR01902        53 ILLAG-HVDTVPG---YIPVKIEGGLLYG   77 (336)
T ss_pred             EEEEc-cccccCC---CcccEEeCCEEEE
Confidence            56777 9999952   1112223457776


No 24 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=24.82  E-value=48  Score=23.66  Aligned_cols=33  Identities=18%  Similarity=0.250  Sum_probs=19.8

Q ss_pred             cccceeeecccccccchhHHHHHHHHhccccccccccCCChHHHHHhc
Q 030263           60 TANFTLCYGVCQIGVIGQKAIAATVASDTVKHSEAFIGKSNQDYCSWI  107 (180)
Q Consensus        60 t~~F~l~C~~C~~~l~lr~~vA~~I~~~p~~y~~~~L~~~~~eYc~~I  107 (180)
                      .....+.|..|+...+.+             .  --|.+|++-|.+||
T Consensus        42 ~~~~~~~C~~Cg~~~~~~-------------i--~~L~epiDVY~~wi   74 (81)
T PF05129_consen   42 EGIGILSCRVCGESFQTK-------------I--NPLSEPIDVYSEWI   74 (81)
T ss_dssp             TTEEEEEESSS--EEEEE-----------------SS--TTHHHHHHH
T ss_pred             CCEEEEEecCCCCeEEEc-------------c--CccCcccchhHHHH
Confidence            456678898996544433             1  24668999999998


No 25 
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=24.65  E-value=63  Score=27.92  Aligned_cols=28  Identities=25%  Similarity=0.468  Sum_probs=23.2

Q ss_pred             HHHHHHHHhHhCceEEEEEcCCCceeee
Q 030263          116 AIELSILADYYGSEIAAYDIQTTRCDLY  143 (180)
Q Consensus       116 ~IEL~iLS~~~~~~I~v~d~~~~~~~~f  143 (180)
                      =|.-.+|++.|+.+|.|.+++++++-.|
T Consensus       223 ii~~~~L~eiydm~i~v~~i~g~kIcvy  250 (252)
T COG4604         223 IIQPEILSEIYDMDIPVEEINGKKICVY  250 (252)
T ss_pred             hcCHHHHHHHhcCCceeEEeCCcEEEEE
Confidence            3566799999999999999998876544


No 26 
>PRK06915 acetylornithine deacetylase; Validated
Probab=24.11  E-value=1.2e+02  Score=26.88  Aligned_cols=13  Identities=31%  Similarity=0.654  Sum_probs=9.9

Q ss_pred             eeecccccceeecc
Q 030263            2 LIYDGLHYDALAIS   15 (180)
Q Consensus         2 liYsGIHYD~l~l~   15 (180)
                      |+|.| |||+++..
T Consensus        96 l~l~~-H~Dtvp~~  108 (422)
T PRK06915         96 MILNG-HIDVVPEG  108 (422)
T ss_pred             EEEEe-eccccCCC
Confidence            46666 99999764


No 27 
>PF05415 Peptidase_C36:  Beet necrotic yellow vein furovirus-type papain-like endopeptidase;  InterPro: IPR008746 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases correspond to MEROPS peptidase family C36 (clan CA). The type example is beet necrotic yellow vein furovirus-type papain-like endopeptidase (beet necrotic yellow vein virus), which is involved in processing the viral polyprotein.
Probab=23.59  E-value=72  Score=23.85  Aligned_cols=32  Identities=19%  Similarity=0.585  Sum_probs=25.5

Q ss_pred             ChHHHHHhcCC--CCCcccHHHHHHHHhHhCceEEEE
Q 030263           99 SNQDYCSWIQD--PEKWGGAIELSILADYYGSEIAAY  133 (180)
Q Consensus        99 ~~~eYc~~I~~--~~~WGG~IEL~iLS~~~~~~I~v~  133 (180)
                      .++.||.|.++  +..|--   -..+++.+++.|.+=
T Consensus        35 ~i~~y~~W~r~~~~STW~D---C~mFA~~LkVsm~vk   68 (104)
T PF05415_consen   35 TIKKYHTWLRKKRPSTWDD---CRMFADALKVSMQVK   68 (104)
T ss_pred             HHHHHHHHHhcCCCCcHHH---HHHHHHhheeEEEEE
Confidence            58899999984  567954   347899999998874


No 28 
>TIGR01246 dapE_proteo succinyl-diaminopimelate desuccinylase, proteobacterial clade. This model describes a proteobacterial subset of succinyl-diaminopimelate desuccinylases. An experimentally confirmed Gram-positive lineage succinyl-diaminopimelate desuccinylase has been described for Corynebacterium glutamicum, and a neighbor-joining tree shows the seed members, SP:Q59284, and putative archaeal members such as TrEMBL:O58003 in a single clade. However, the archaeal members differ substantially, share a number of motifs with acetylornithine deacetylases rather than succinyl-diaminopimelate desuccinylases, and are not taken as trusted examples of succinyl-diaminopimelate desuccinylases. This model is limited to proteobacterial members for this reason.
Probab=23.47  E-value=4.4e+02  Score=22.73  Aligned_cols=13  Identities=31%  Similarity=0.647  Sum_probs=10.0

Q ss_pred             eeecccccceeecc
Q 030263            2 LIYDGLHYDALAIS   15 (180)
Q Consensus         2 liYsGIHYD~l~l~   15 (180)
                      |++.| |+|+++..
T Consensus        58 i~~~~-H~DtVp~~   70 (370)
T TIGR01246        58 LAFAG-HTDVVPAG   70 (370)
T ss_pred             EEEEc-cccccCCC
Confidence            56667 99999764


No 29 
>COG3426 Butyrate kinase [Energy production and conversion]
Probab=22.20  E-value=59  Score=29.35  Aligned_cols=25  Identities=36%  Similarity=0.488  Sum_probs=20.9

Q ss_pred             hHHHHHhcCCCCCcccHHHHHHHHh
Q 030263          100 NQDYCSWIQDPEKWGGAIELSILAD  124 (180)
Q Consensus       100 ~~eYc~~I~~~~~WGG~IEL~iLS~  124 (180)
                      ..+|.+||..---..|+.||.+|+.
T Consensus       316 I~~~v~~iapv~v~PGE~EleALA~  340 (358)
T COG3426         316 IEDRVSWIAPVIVYPGEDELEALAE  340 (358)
T ss_pred             HHHHHhhhcceEecCCchHHHHHHh
Confidence            6677777777777899999999986


No 30 
>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat. Domain found in inhibitor of apoptosis proteins (IAPs) and other proteins. Acts as a direct inhibitor of caspase enzymes.
Probab=21.75  E-value=42  Score=22.42  Aligned_cols=32  Identities=9%  Similarity=-0.127  Sum_probs=20.0

Q ss_pred             hcCCCcccccceeeecccccccchhHHHHHHHH
Q 030263           53 RKKTYTDTANFTLCYGVCQIGVIGQKAIAATVA   85 (180)
Q Consensus        53 ~~~~~Tdt~~F~l~C~~C~~~l~lr~~vA~~I~   85 (180)
                      .-=|||.+ +-.++|..|+..+......-+...
T Consensus        26 ~Gfyy~~~-~d~v~C~~C~~~l~~w~~~d~p~~   57 (71)
T smart00238       26 AGFYYTGV-GDEVKCFFCGGELDNWEPGDDPWE   57 (71)
T ss_pred             cCCeECCC-CCEEEeCCCCCCcCCCCCCCCHHH
Confidence            33445544 667999999988876643333333


No 31 
>PRK12301 bssS biofilm formation regulatory protein BssS; Reviewed
Probab=21.11  E-value=74  Score=23.19  Aligned_cols=36  Identities=22%  Similarity=0.338  Sum_probs=20.0

Q ss_pred             cceeecc----CCCCCCCC---CCeeeeeCCCCCccchHHHHHHHHHHHHHh
Q 030263            9 YDALAIS----PFEGAPEE---FDQTIFPVQKGRTIGPAEDLALKLVKEQQR   53 (180)
Q Consensus         9 YD~l~l~----~~~~~~~~---~d~t~F~~~d~~~l~~~~~~A~~L~~~lk~   53 (180)
                      |||+.+.    ++++-|++   .|+|.|=+.|         .|++|...|++
T Consensus        24 YDAmmirlhyLss~~Q~~e~A~v~~tlwLTtd---------vArqlI~iLea   66 (84)
T PRK12301         24 YDALMLRLHYQSPNDQEPEGAEVGQTLWLTTD---------VARQFISILEA   66 (84)
T ss_pred             HhhHHHhhhhcCCCCCCcccccccceEEecHH---------HHHHHHHHHHH
Confidence            7888764    23333332   5778775543         45666665543


No 32 
>COG5554 NifU Nitrogen fixation protein [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=20.77  E-value=16  Score=25.30  Aligned_cols=21  Identities=24%  Similarity=0.503  Sum_probs=15.5

Q ss_pred             CChHHHHHhcCCCCCcccHHH
Q 030263           98 KSNQDYCSWIQDPEKWGGAIE  118 (180)
Q Consensus        98 ~~~~eYc~~I~~~~~WGG~IE  118 (180)
                      ++.+|=.-.+.+++-|||.|=
T Consensus        19 KDLEEpii~V~nedlwGG~il   39 (69)
T COG5554          19 KDLEEPIIVVKNEDLWGGKIL   39 (69)
T ss_pred             cccccceEEEeccccccceEE
Confidence            556666667788899999763


No 33 
>PRK10963 hypothetical protein; Provisional
Probab=20.73  E-value=87  Score=26.14  Aligned_cols=37  Identities=14%  Similarity=0.205  Sum_probs=29.4

Q ss_pred             hHHHHHHHHhccccccccccCCChHHHHHhcCCCCCcccHHHH
Q 030263           77 QKAIAATVASDTVKHSEAFIGKSNQDYCSWIQDPEKWGGAIEL  119 (180)
Q Consensus        77 r~~vA~~I~~~p~~y~~~~L~~~~~eYc~~I~~~~~WGG~IEL  119 (180)
                      .+.+|+|.+.||+-|..      ..+-...|+=|..+||+|=|
T Consensus         5 ~~~V~~yL~~~PdFf~~------h~~Ll~~L~lph~~~gaVSL   41 (223)
T PRK10963          5 DRAVVDYLLQNPDFFIR------NARLVEQMRVPHPVRGTVSL   41 (223)
T ss_pred             HHHHHHHHHHCchHHhh------CHHHHHhccCCCCCCCeecH
Confidence            45799999999998765      45667789989889997643


No 34 
>cd02426 Pol_gamma_b_Cterm C-terminal domain of mitochondrial DNA polymerase gamma B subunit, which is required for processivity. Polymerase gamma replicates and repairs mitochondrial DNA. The c-terminal domain of its B subunit is strikingly similar to the anticodon-binding domain of glycyl tRNA synthetase.
Probab=20.67  E-value=1.9e+02  Score=22.02  Aligned_cols=31  Identities=16%  Similarity=0.088  Sum_probs=24.1

Q ss_pred             CCeeeeeCCCCCccchHHHHHHHHHHHHHhcCC
Q 030263           24 FDQTIFPVQKGRTIGPAEDLALKLVKEQQRKKT   56 (180)
Q Consensus        24 ~d~t~F~~~d~~~l~~~~~~A~~L~~~lk~~~~   56 (180)
                      ++..|+|++...  +.+.+.|.+|.++|++++.
T Consensus        28 ~qV~Iipi~~~~--~~~~~~a~~l~~~L~~~gi   58 (128)
T cd02426          28 YKVAIDCGKGDT--AELRDLCQGLKNELREAGL   58 (128)
T ss_pred             eEEEEEeccCCh--HHHHHHHHHHHHHHHHcCC
Confidence            678899985432  5677899999999988763


No 35 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=20.01  E-value=95  Score=15.87  Aligned_cols=17  Identities=6%  Similarity=0.174  Sum_probs=12.0

Q ss_pred             eecccccccchhHHHHH
Q 030263           66 CYGVCQIGVIGQKAIAA   82 (180)
Q Consensus        66 ~C~~C~~~l~lr~~vA~   82 (180)
                      +|..|+..+.-+.....
T Consensus         2 ~C~~C~~~f~~~~~l~~   18 (23)
T PF00096_consen    2 KCPICGKSFSSKSNLKR   18 (23)
T ss_dssp             EETTTTEEESSHHHHHH
T ss_pred             CCCCCCCccCCHHHHHH
Confidence            58899988776654444


Done!