Citrus Sinensis ID: 030296

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MVRVVVDMNSGGGGSGVGGTSTSSWVSTTSVSASGKRIQREMAELNMDPPQDCSAGPKGDNLYNWVATIIGPAGTPYQGGIFFLDITFPTDYPFKPPKVAFLTRIYHCNVDSAGNVNLDILKDSWSPALTITKVLLAVRSMFTNPSLHNPIVPGIAHLYLEDKAKHDQLAAEWTLRFAK
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccEEEEcccccEEEEEEEEccccccccccEEEEEEEccccccccccEEEEEcccccccccccccEEEEcccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHcHHHHHHHHHHHHHHHcc
****************************************EMAELNMDPPQDCSAGPKGDNLYNWVATIIGPAGTPYQGGIFFLDITFPTDYPFKPPKVAFLTRIYHCNVDSAGNVNLDILKDSWSPALTITKVLLAVRSMFTNPSLHNPIVPGIAHLYLEDKAKHDQLAAEWTLRFAK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRVVVDMNSGGGGSGVGGTSTSSWVSTTSVSASGKRIQREMAELNMDPPQDCSAGPKGDNLYNWVATIIGPAGTPYQGGIFFLDITFPTDYPFKPPKVAFLTRIYHCNVDSAGNVNLDILKDSWSPALTITKVLLAVRSMFTNPSLHNPIVPGIAHLYLEDKAKHDQLAAEWTLRFAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Constitutive photomorphogenesis protein 10 Component of light signal transduction machinery. Involved in repression of photomorphogenesis in darkness by participating in the CDD complex, a complex probably required to regulate the activity of ubiquitin conjugating enzymes (E2s). Repression of photomorphogenesis is probably mediated by ubiquitination and subsequent degradation of photomorphogenesis-promoting factors such as HY5, HYH and LAF1. Although strongly related to ubiquitin-conjugating enzyme, it has no catalytic activity by itself due to the absence of the conserved Cys active site at position 120. It can however enhance the activity of E2 conjugating enzymes.probableQ9LJD7
Ubiquitin-conjugating enzyme E2-16 kDa Catalyzes the covalent attachment of ubiquitin to other proteins. Mediates the selective degradation of short-lived and abnormal proteins.probableP15732
Ubiquitin-conjugating enzyme E2-24 kDa Catalyzes the covalent attachment of ubiquitin to other proteins.probableP52485

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BZH, chain A
Confidence level:very confident
Coverage over the Query: 31-179
View the alignment between query and template
View the model in PyMOL