BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030301
         (179 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3GG2|A Chain A, Crystal Structure Of Udp-Glucose 6-Dehydrogenase From
           Porphyromonas Gingivalis Bound To Product
           Udp-Glucuronate
 pdb|3GG2|B Chain B, Crystal Structure Of Udp-Glucose 6-Dehydrogenase From
           Porphyromonas Gingivalis Bound To Product
           Udp-Glucuronate
 pdb|3GG2|C Chain C, Crystal Structure Of Udp-Glucose 6-Dehydrogenase From
           Porphyromonas Gingivalis Bound To Product
           Udp-Glucuronate
 pdb|3GG2|D Chain D, Crystal Structure Of Udp-Glucose 6-Dehydrogenase From
           Porphyromonas Gingivalis Bound To Product
           Udp-Glucuronate
          Length = 450

 Score = 28.1 bits (61), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 23/57 (40%), Gaps = 10/57 (17%)

Query: 57  LDADFKANAGATKEGSKADDELKKQR----------RPFLLQFFSPIFLKAFSITFF 103
           +D D  +N    KEG+  DD +K  R          R  +   + P+ L  F + F 
Sbjct: 147 IDFDIASNPEFLKEGNAIDDFMKPDRVVVGVDSDRARELITSLYKPMLLNNFRVLFM 203


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.139    0.418 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,978,264
Number of Sequences: 62578
Number of extensions: 176868
Number of successful extensions: 392
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 390
Number of HSP's gapped (non-prelim): 3
length of query: 179
length of database: 14,973,337
effective HSP length: 93
effective length of query: 86
effective length of database: 9,153,583
effective search space: 787208138
effective search space used: 787208138
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)