Query         030305
Match_columns 179
No_of_seqs    31 out of 33
Neff          3.1 
Searched_HMMs 46136
Date          Fri Mar 29 11:42:49 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030305.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030305hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04530 Viral_Beta_CD:  Viral   48.2     6.3 0.00014   31.9   0.1   13  101-113    80-92  (122)
  2 PF15513 DUF4651:  Domain of un  40.3      25 0.00053   25.5   2.2   18   25-42      3-20  (62)
  3 KOG2435 Uncharacterized conser  37.8      22 0.00047   32.7   1.9   48  110-164   262-321 (323)
  4 PF09932 DUF2164:  Uncharacteri  36.4      38 0.00082   24.9   2.7   20   20-39      2-21  (76)
  5 PRK11546 zraP zinc resistance   36.3      17 0.00037   29.8   0.9   26   20-45     43-68  (143)
  6 PF00140 Sigma70_r1_2:  Sigma-7  36.2      28  0.0006   21.9   1.7   19   19-37     15-33  (37)
  7 PF15477 SMAP:  Small acidic pr  34.5      54  0.0012   23.2   3.1   38    3-40     20-57  (69)
  8 PF13801 Metal_resist:  Heavy-m  31.8      50  0.0011   23.0   2.6   26   19-44     40-65  (125)
  9 COG2979 Uncharacterized protei  29.4      43 0.00093   29.7   2.3   21   15-35    121-141 (225)
 10 COG3866 PelB Pectate lyase [Ca  27.6      38 0.00083   31.6   1.8   54   97-164   264-321 (345)
 11 smart00309 PAH Pancreatic horm  26.4 1.4E+02  0.0031   19.5   3.8   30   12-41      3-32  (36)
 12 PF04391 DUF533:  Protein of un  26.3      56  0.0012   27.6   2.4   21   15-35     90-110 (188)
 13 cd00225 API3 Ascaris pepsin in  26.3      74  0.0016   26.9   3.1   36   20-55     30-97  (159)
 14 PF14480 DNA_pol3_a_NI:  DNA po  26.0      72  0.0016   21.8   2.5   25   17-41     44-68  (76)
 15 PRK10201 G/U mismatch-specific  24.0 1.1E+02  0.0024   25.4   3.7   34    5-38     63-97  (168)
 16 PF00159 Hormone_3:  Pancreatic  21.1 2.2E+02  0.0047   18.6   3.8   30   12-41      3-32  (36)
 17 PF01213 CAP_N:  Adenylate cycl  21.0      19 0.00042   32.5  -1.4   18  106-123   192-209 (312)

No 1  
>PF04530 Viral_Beta_CD:  Viral Beta C/D like family;  InterPro: IPR007617 This is a family of ssRNA positive-strand viral proteins. Conserved region is found in the Beta C and Beta D transcripts.
Probab=48.20  E-value=6.3  Score=31.89  Aligned_cols=13  Identities=23%  Similarity=0.575  Sum_probs=10.8

Q ss_pred             hhhhhhccccccc
Q 030305          101 VETQYYKQLVSID  113 (179)
Q Consensus       101 VETeYYkdL~~ID  113 (179)
                      .=++||||||+|-
T Consensus        80 ~~syfyQDLNsVe   92 (122)
T PF04530_consen   80 KGSYFYQDLNSVE   92 (122)
T ss_pred             ccchheeeccceE
Confidence            4478999999975


No 2  
>PF15513 DUF4651:  Domain of unknown function (DUF4651)
Probab=40.32  E-value=25  Score=25.48  Aligned_cols=18  Identities=11%  Similarity=0.287  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHhhhhcCC
Q 030305           25 EQVRIANRVRAQIDSMAP   42 (179)
Q Consensus        25 eq~~i~~evRa~FD~~AP   42 (179)
                      .|++|.++||+||-.|-+
T Consensus         3 kre~i~~~iR~~fs~lG~   20 (62)
T PF15513_consen    3 KREEITAEIRQFFSQLGE   20 (62)
T ss_pred             HHHHHHHHHHHHHHhcCc
Confidence            688999999999987743


No 3  
>KOG2435 consensus Uncharacterized conserved protein [Function unknown]
Probab=37.82  E-value=22  Score=32.74  Aligned_cols=48  Identities=17%  Similarity=0.180  Sum_probs=37.2

Q ss_pred             ccccccC-----CCCCccceEEeecCCceeEeeCCCCCCCCCCccccCCC-------CCCCccCCcc
Q 030305          110 VSIDKDH-----HTTGTGFIRVANEGNGYNIRVANGCDSGDRPVYKSNPA-------TNDWIPSVEY  164 (179)
Q Consensus       110 ~~IDKqH-----HTTGtGFIKv~k~~~~f~i~~~~~~~~~~~~~~ksNPA-------TNDWiPa~~~  164 (179)
                      .-+|.||     |+++.||--++|-++.|.|..|-..       .+..|+       -|+|+|++..
T Consensus       262 riqDrq~e~nl~~vssig~sl~dk~dGpF~LEIDfIG-------v~~d~~H~EdFayE~y~~p~~r~  321 (323)
T KOG2435|consen  262 RIQDRQHELNLDKVSSIGFSLADKVDGPFFLEIDFIG-------VFTDPAHTEDFAYENYPEPNPRL  321 (323)
T ss_pred             ceeecccccCccceeeEeEEEeeccCCcceeeEEEEE-------EecCCCcccceeeeccccccccc
Confidence            4578888     8999999999996698999887643       455565       5889998753


No 4  
>PF09932 DUF2164:  Uncharacterized conserved protein (DUF2164);  InterPro: IPR018680 This family of various hypothetical prokaryotic proteins has no known function.
Probab=36.44  E-value=38  Score=24.90  Aligned_cols=20  Identities=10%  Similarity=0.272  Sum_probs=18.1

Q ss_pred             ccCHHHHHHHHHHHHHhhhh
Q 030305           20 VLDAVEQVRIANRVRAQIDS   39 (179)
Q Consensus        20 ~L~~Eeq~~i~~evRa~FD~   39 (179)
                      -|+.|+++++..+|+.||..
T Consensus         2 ~l~ke~k~~li~~iq~yf~~   21 (76)
T PF09932_consen    2 KLSKEEKAELIDKIQRYFAE   21 (76)
T ss_pred             cCCHHHHHHHHHHHHHHHHH
Confidence            48999999999999999964


No 5  
>PRK11546 zraP zinc resistance protein; Provisional
Probab=36.27  E-value=17  Score=29.81  Aligned_cols=26  Identities=12%  Similarity=-0.010  Sum_probs=23.6

Q ss_pred             ccCHHHHHHHHHHHHHhhhhcCCCCC
Q 030305           20 VLDAVEQVRIANRVRAQIDSMAPKRP   45 (179)
Q Consensus        20 ~L~~Eeq~~i~~evRa~FD~~APKRp   45 (179)
                      -|+||+|+++..-..+|++..+|-|-
T Consensus        43 ~LT~EQQa~~q~I~~~f~~~t~~LRq   68 (143)
T PRK11546         43 PLTTEQQAAWQKIHNDFYAQTSALRQ   68 (143)
T ss_pred             cCCHHHHHHHHHHHHHHHHHHHHHHH
Confidence            49999999999999999999998774


No 6  
>PF00140 Sigma70_r1_2:  Sigma-70 factor, region 1.2;  InterPro: IPR009042 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ]. ; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 1SMY_F 1IW7_P 1SIG_A 3IYD_F 2BE5_F 2A6E_F 2CW0_F 2A69_P 2A6H_P 3DXJ_P ....
Probab=36.23  E-value=28  Score=21.89  Aligned_cols=19  Identities=32%  Similarity=0.482  Sum_probs=15.8

Q ss_pred             cccCHHHHHHHHHHHHHhh
Q 030305           19 EVLDAVEQVRIANRVRAQI   37 (179)
Q Consensus        19 e~L~~Eeq~~i~~evRa~F   37 (179)
                      .-|++||+..++.+|+.--
T Consensus        15 ~LLt~eeE~~LA~~i~~g~   33 (37)
T PF00140_consen   15 PLLTAEEEIELARRIRKGD   33 (37)
T ss_dssp             -EETTHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHhH
Confidence            4699999999999998753


No 7  
>PF15477 SMAP:  Small acidic protein family
Probab=34.49  E-value=54  Score=23.23  Aligned_cols=38  Identities=13%  Similarity=0.212  Sum_probs=29.3

Q ss_pred             eecccceeecCCCCcccccCHHHHHHHHHHHHHhhhhc
Q 030305            3 LAGVDQWTVTKPSRSDEVLDAVEQVRIANRVRAQIDSM   40 (179)
Q Consensus         3 ~~~vg~m~~~kPsRSDe~L~~Eeq~~i~~evRa~FD~~   40 (179)
                      |||+.--...-++.....++.+++.++.+++..+|+.-
T Consensus        20 LMG~kk~~~~~~~~~~~~~~~~~~~~l~~~Le~Qy~~a   57 (69)
T PF15477_consen   20 LMGGKKAGASAAASPNMALSKEKQEKLQQDLEQQYEAA   57 (69)
T ss_pred             HhcCCCCCCCCCCCccccccHHHHHHHHHHHHHHHHHH
Confidence            56655533444567788899999999999999999864


No 8  
>PF13801 Metal_resist:  Heavy-metal resistance; PDB: 3EPV_C 2Y3D_A 2Y3H_D 2Y3G_B 2Y3B_A 2Y39_A 3LAY_H.
Probab=31.76  E-value=50  Score=22.99  Aligned_cols=26  Identities=15%  Similarity=0.109  Sum_probs=21.0

Q ss_pred             cccCHHHHHHHHHHHHHhhhhcCCCC
Q 030305           19 EVLDAVEQVRIANRVRAQIDSMAPKR   44 (179)
Q Consensus        19 e~L~~Eeq~~i~~evRa~FD~~APKR   44 (179)
                      .-||+|++.+|.+..++|+..+.+-|
T Consensus        40 l~Lt~eQ~~~l~~~~~~~~~~~~~~r   65 (125)
T PF13801_consen   40 LNLTPEQQAKLRALMDEFRQEMRALR   65 (125)
T ss_dssp             S-TTHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cCCCHHHHHHHHHHHHHHHHHHHHHH
Confidence            47999999999999999998765433


No 9  
>COG2979 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.42  E-value=43  Score=29.67  Aligned_cols=21  Identities=24%  Similarity=0.517  Sum_probs=18.7

Q ss_pred             CCcccccCHHHHHHHHHHHHH
Q 030305           15 SRSDEVLDAVEQVRIANRVRA   35 (179)
Q Consensus        15 sRSDe~L~~Eeq~~i~~evRa   35 (179)
                      .+||-|++..|+++|+.+|+.
T Consensus       121 AkaDGhIDe~ERa~I~~~l~e  141 (225)
T COG2979         121 AKADGHIDEKERARIMQKLQE  141 (225)
T ss_pred             HhhcCCcCHHHHHHHHHHHHH
Confidence            579999999999999987764


No 10 
>COG3866 PelB Pectate lyase [Carbohydrate transport and metabolism]
Probab=27.60  E-value=38  Score=31.61  Aligned_cols=54  Identities=26%  Similarity=0.462  Sum_probs=37.0

Q ss_pred             chhhhhhhhhcccccccccCCCCCccceEEeecCCceeEe-eCCCCCCCCCCccccCCCC---CCCccCCcc
Q 030305           97 QDEFVETQYYKQLVSIDKDHHTTGTGFIRVANEGNGYNIR-VANGCDSGDRPVYKSNPAT---NDWIPSVEY  164 (179)
Q Consensus        97 ~eEFVETeYYkdL~~IDKqHHTTGtGFIKv~k~~~~f~i~-~~~~~~~~~~~~~ksNPAT---NDWiPa~~~  164 (179)
                      -+=|||--||..+        +-|.||++--.. .+|-.+ ...+     ..+||+++-+   +-|-|++..
T Consensus       264 AkiyvE~NyF~~~--------~~~~~f~dt~~~-~GY~~~d~gsy-----~~~s~~~~~~~~G~~w~ps~~Y  321 (345)
T COG3866         264 AKIYVENNYFENG--------SEGLGFLDTKGT-SGYANQDSGSY-----LNSSKSMSVRAGGVTWNPSSYY  321 (345)
T ss_pred             eEEEEecceeccC--------CCCceeeecCCc-cceEEeccCce-----ecccCCcccccCCccCCCCCCc
Confidence            4679999999988        556777765543 234332 2222     2788888888   999999865


No 11 
>smart00309 PAH Pancreatic hormones / neuropeptide F / peptide YY family. Pancreatic hormone is a regulator of pancreatic and gastrointestinal functions.
Probab=26.40  E-value=1.4e+02  Score=19.49  Aligned_cols=30  Identities=17%  Similarity=0.279  Sum_probs=26.1

Q ss_pred             cCCCCcccccCHHHHHHHHHHHHHhhhhcC
Q 030305           12 TKPSRSDEVLDAVEQVRIANRVRAQIDSMA   41 (179)
Q Consensus        12 ~kPsRSDe~L~~Eeq~~i~~evRa~FD~~A   41 (179)
                      .+|-|--+--++||-++--+++|.||--+.
T Consensus         3 ~~P~~Pg~~a~~e~l~~Y~~~L~~Yinlit   32 (36)
T smart00309        3 SKPERPGDDASPEDLRQYLAALREYINLIT   32 (36)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHhc
Confidence            468888888899999999999999998765


No 12 
>PF04391 DUF533:  Protein of unknown function (DUF533);  InterPro: IPR007486 Some family members may be secreted or integral membrane proteins.
Probab=26.31  E-value=56  Score=27.59  Aligned_cols=21  Identities=24%  Similarity=0.442  Sum_probs=18.4

Q ss_pred             CCcccccCHHHHHHHHHHHHH
Q 030305           15 SRSDEVLDAVEQVRIANRVRA   35 (179)
Q Consensus        15 sRSDe~L~~Eeq~~i~~evRa   35 (179)
                      .++|-|++.+|+.+|..++.+
T Consensus        90 AkADG~ID~~Er~~I~~~l~~  110 (188)
T PF04391_consen   90 AKADGHIDEEERQRIEGALQE  110 (188)
T ss_pred             HHcCCCCCHHHHHHHHHHHHH
Confidence            579999999999999887765


No 13 
>cd00225 API3 Ascaris pepsin inhibitor-3 (API3); protein inhibitor that reversibly inhibits aspartic proteinase cathepsin E, and gastric enzymes pepsin and gastricsin.
Probab=26.27  E-value=74  Score=26.92  Aligned_cols=36  Identities=33%  Similarity=0.490  Sum_probs=24.9

Q ss_pred             ccCHHHHHHHH---HHHHHhhhhcC-----------------------------CCCCCCCCCCCCCC
Q 030305           20 VLDAVEQVRIA---NRVRAQIDSMA-----------------------------PKRPTKPNRSEPDS   55 (179)
Q Consensus        20 ~L~~Eeq~~i~---~evRa~FD~~A-----------------------------PKRp~KP~RSE~s~   55 (179)
                      -|+++||...+   +++-+|=+++.                             ||+|.||+=--+++
T Consensus        30 eLt~~Eq~el~~y~~d~~~yK~~~k~~l~er~~~~~~~~~~~~~~~~~~~~~~~Pk~PkkPsFCt~~D   97 (159)
T cd00225          30 ELTPDEQQELAQYVEDVADYKEEVKQALKERQEGLKLRRAGKKKKAVTLAEEKLPKAPKKPSFCSPDD   97 (159)
T ss_pred             eCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhcccccccccccccCCCCCCCCCcCCCCc
Confidence            36777776554   45556666666                             99999998766653


No 14 
>PF14480 DNA_pol3_a_NI:  DNA polymerase III polC-type N-terminus I
Probab=25.97  E-value=72  Score=21.80  Aligned_cols=25  Identities=16%  Similarity=0.259  Sum_probs=23.5

Q ss_pred             cccccCHHHHHHHHHHHHHhhhhcC
Q 030305           17 SDEVLDAVEQVRIANRVRAQIDSMA   41 (179)
Q Consensus        17 SDe~L~~Eeq~~i~~evRa~FD~~A   41 (179)
                      |+..|+.+.-..+++.++..|..+|
T Consensus        44 ~~~~l~~~~~~~~~~~l~~~F~~ia   68 (76)
T PF14480_consen   44 SPHILPFEVYQKFEEKLKKQFSHIA   68 (76)
T ss_pred             eCCcCCHHHHHHHHHHHHHHhCCcC
Confidence            7899999999999999999998876


No 15 
>PRK10201 G/U mismatch-specific DNA glycosylase; Provisional
Probab=23.95  E-value=1.1e+02  Score=25.36  Aligned_cols=34  Identities=12%  Similarity=0.131  Sum_probs=22.8

Q ss_pred             ccccee-ecCCCCcccccCHHHHHHHHHHHHHhhh
Q 030305            5 GVDQWT-VTKPSRSDEVLDAVEQVRIANRVRAQID   38 (179)
Q Consensus         5 ~vg~m~-~~kPsRSDe~L~~Eeq~~i~~evRa~FD   38 (179)
                      ++|=|- +.||.+.|.-|+.+|...-.+.+++.|.
T Consensus        63 giGltdvv~Rpt~~aseL~~~E~~~g~~~L~~~i~   97 (168)
T PRK10201         63 RCGVTKLVDRPTVQANEVSKQELRSGGRKLIEKIE   97 (168)
T ss_pred             CcceeeeeecCCcChhhcCHHHHHhhHHHHHHHHH
Confidence            445554 7899999999999996444444444443


No 16 
>PF00159 Hormone_3:  Pancreatic hormone peptide;  InterPro: IPR001955 Pancreatic hormone (PP) [] is a peptide synthesized in pancreatic islets of Langherhans, which acts as a regulator of pancreatic and gastrointestinal functions. The hormone is produced as a larger propeptide, which is enzymatically cleaved to yield the mature active peptide: this is 36 amino acids in length [] and has an amidated C terminus []. The hormone has a globular structure, residues 2-8 forming a left-handed poly-proline-II-like helix, residues 9-13 a beta turn, and 14-32 an alpha-helix,held close to the first helix by hydrophobic interactions []. Unlike glucagon, another peptide hormone, the structure of pancreatic peptide is preserved in aqueous solution []. Both N and C termini are required for activity: receptor binding and activation functions may reside in the N and C termini respectively []. Pancreatic hormone is part of a wider family of active peptides that includes:  Neuropeptide Y (NPY) [], one of the most abundant peptides in the mammalian nervous system. NPY is implicated in the control of feeding and the secretion of the gonadotrophin-releasing hormone. Peptide YY (PYY) []. PPY is a gut peptide that inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibits jejunal and colonic mobility. Various NPY and PYY-like polypeptides from fish and amphibians [, ]. Neuropeptide F (NPF) from invertebrates such as worms and snail. Skin peptide Tyr-Tyr (SPYY) from the frog Phyllomedusa bicolor. SPYY shows a large spectra of antibacterial and antifungal activity.  All these peptides are 36 to 39 amino acids long. Like most active peptides, their C-terminal is amidated and they are synthesized as larger protein precursors.; GO: 0005179 hormone activity, 0005576 extracellular region; PDB: 1LJV_A 1BBA_A 1V1D_A 1PPT_A 2H3T_A 2H4B_A 2BF9_A 2H3S_B 1K8V_A 2DF0_A ....
Probab=21.05  E-value=2.2e+02  Score=18.57  Aligned_cols=30  Identities=20%  Similarity=0.316  Sum_probs=25.9

Q ss_pred             cCCCCcccccCHHHHHHHHHHHHHhhhhcC
Q 030305           12 TKPSRSDEVLDAVEQVRIANRVRAQIDSMA   41 (179)
Q Consensus        12 ~kPsRSDe~L~~Eeq~~i~~evRa~FD~~A   41 (179)
                      .||-|--+.-++||-++--.++|.||--+.
T Consensus         3 ~~P~~P~~~aspeel~~Y~~~L~~Y~~lvt   32 (36)
T PF00159_consen    3 SKPERPGDFASPEELAQYYAALRHYINLVT   32 (36)
T ss_dssp             SSSSSSSTTSSHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHc
Confidence            478888888899999999999999997665


No 17 
>PF01213 CAP_N:  Adenylate cyclase associated (CAP) N terminal;  InterPro: IPR013992  Cyclase-associated proteins (CAPs) are highly conserved actin-binding proteins present in a wide range of organisms including yeast, fly, plants, and mammals. CAPs are multifunctional proteins that contain several structural domains. CAP is involved in species-specific signalling pathways [, , , ]. In Drosophila, CAP functions in Hedgehog-mediated eye development and in establishing oocyte polarity. In Dictyostelium (slim mold), CAP is involved in microfilament reorganisation near the plasma membrane in a PIP2-regulated manner and is required to perpetuate the cAMP relay signal to organise fruitbody formation. In plants, CAP is involved in plant signalling pathways required for co-ordinated organ expansion. In yeast, CAP is involved in adenylate cyclase activation, as well as in vesicle trafficking and endocytosis. In both yeast and mammals, CAPs appear to be involved in recycling G-actin monomers from ADF/cofilins for subsequent rounds of filament assembly [, ]. In mammals, there are two different CAPs (CAP1 and CAP2) that share 64% amino acid identity.  All CAPs appear to contain a C-terminal actin-binding domain that regulates actin remodelling in response to cellular signals and is required for normal cellular morphology, cell division, growth and locomotion in eukaryotes. CAP directly regulates actin filament dynamics and has been implicated in a number of complex developmental and morphological processes, including mRNA localisation and the establishment of cell polarity. Actin exists both as globular (G) (monomeric) actin subunits and assembled into filamentous (F) actin. In cells, actin cycles between these two forms. Proteins that bind F-actin often regulate F-actin assembly and its interaction with other proteins, while proteins that interact with G-actin often control the availability of unpolymerised actin. CAPs bind G-actin.  In addition to actin-binding, CAPs can have additional roles, and may act as bifunctional proteins. In Saccharomyces cerevisiae (Baker's yeast), CAP is a component of the adenylyl cyclase complex (Cyr1p) that serves as an effector of Ras during normal cell signalling. S. cerevisiae CAP functions to expose adenylate cyclase binding sites to Ras, thereby enabling adenylate cyclase to be activated by Ras regulatory signals. In Schizosaccharomyces pombe (Fission yeast), CAP is also required for adenylate cyclase activity, but not through the Ras pathway. In both organisms, the N-terminal domain is responsible for adenylate cyclase activation, but the S cerevisiae and S. pombe N-termini cannot complement one another. Yeast CAPs are unique among the CAP family of proteins, because they are the only ones to directly interact with and activate adenylate cyclase []. S. cerevisiae CAP has four major domains. In addition to the N-terminal adenylate cyclase-interacting domain, and the C-terminal actin-binding domain, it possesses two other domains: a proline-rich domain that interacts with Src homology 3 (SH3) domains of specific proteins, and a domain that is responsible for CAP oligomerisation to form multimeric complexes (although oligomerisation appears to involve the N- and C-terminal domains as well). The proline-rich domain interacts with profilin, a protein that catalyses nucleotide exchange on G-actin monomers and promotes addition to barbed ends of filamentous F-actin []. Since CAP can bind profilin via a proline-rich domain, and G-actin via a C-terminal domain, it has been suggested that a ternary G-actin/CAP/profilin complex could be formed. This entry represents the N-terminal domain of CAP proteins. This domain has an all-alpha structure consisting of six helices in a bundle with a left-handed twist and an up-and-down topology [].; GO: 0003779 actin binding, 0007010 cytoskeleton organization; PDB: 1TJF_B 1S0P_A.
Probab=20.95  E-value=19  Score=32.49  Aligned_cols=18  Identities=44%  Similarity=0.687  Sum_probs=12.5

Q ss_pred             hcccccccccCCCCCccc
Q 030305          106 YKQLVSIDKDHHTTGTGF  123 (179)
Q Consensus       106 YkdL~~IDKqHHTTGtGF  123 (179)
                      +++|-..=|+|||||--|
T Consensus       192 ~~~L~~YVke~httGl~W  209 (312)
T PF01213_consen  192 LKELQAYVKEHHTTGLSW  209 (312)
T ss_dssp             HHHHHHHHHHHSTTS---
T ss_pred             HHHHHHHHHHhCccCccc
Confidence            567777779999999655


Done!