Query         030306
Match_columns 179
No_of_seqs    108 out of 873
Neff          6.3 
Searched_HMMs 46136
Date          Fri Mar 29 11:43:49 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030306.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030306hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 7.7E-41 1.7E-45  255.4   6.8  124    2-146     3-129 (129)
  2 PF07960 CBP4:  CBP4;  InterPro  26.7      49  0.0011   25.5   2.0   16    7-22     30-49  (128)
  3 PF01473 CW_binding_1:  Putativ  25.1      52  0.0011   16.4   1.3    8   71-78      7-14  (19)
  4 PF13822 ACC_epsilon:  Acyl-CoA  25.0      37  0.0008   22.6   0.9   19    6-24      9-30  (62)
  5 cd00490 Met_repressor_MetJ Met  18.4 1.2E+02  0.0027   22.1   2.5   37    7-50     50-89  (103)
  6 smart00707 RPEL Repeat in Dros  18.1      84  0.0018   17.6   1.3   12    5-16      8-19  (26)
  7 PF07131 DUF1382:  Protein of u  17.6 1.1E+02  0.0024   20.6   1.9   21    2-22     22-49  (61)
  8 PRK05264 transcriptional repre  16.3 1.4E+02   0.003   21.9   2.4   37    7-50     51-90  (105)
  9 cd01785 PDZ_GEF_RA Ubiquitin-l  16.1      64  0.0014   23.1   0.6   31  136-170    29-60  (85)
 10 PF04700 Baculo_gp41:  Structur  15.6 1.4E+02  0.0031   24.5   2.5   21    5-26      3-26  (186)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=7.7e-41  Score=255.37  Aligned_cols=124  Identities=28%  Similarity=0.533  Sum_probs=91.9

Q ss_pred             CCCccCCChHHHHHH-HHHhhcCCCCCCCCCceeeccC--CCCCCcCccchhhhhccccccccCCCCCCCCCCceEEEee
Q 030306            2 ETDPYNPFDQSLIKQ-LNNKIIDEPVEFPDLITTEIND--HHPADFFPGSLLRAFCTSFNNVQLPKGGDRDREKGCYVLT   78 (179)
Q Consensus         2 ~g~RF~PTDeELI~~-L~~Ki~g~pl~~~~~~I~~~Dv--~~Pw~~Lp~~~~~~~~~~~~~~~~~~g~~~~~~~~wyFFs   78 (179)
                      -||||+|||+|||.+ |++|+.|.+++ ..++|+++||  +|||+ |++...                  .++.+||||+
T Consensus         3 ~G~rF~PtD~ELi~~yL~~k~~g~~~~-~~~~i~~~Diy~~~P~~-L~~~~~------------------~~~~~~yFF~   62 (129)
T PF02365_consen    3 PGFRFRPTDEELINHYLRPKILGEPLP-CEDVIHDVDIYSAHPWE-LPAKFK------------------GGDEEWYFFS   62 (129)
T ss_dssp             TTEEE---HHHHHHCTHHHHHTT-HHC-S-CHSEE--GGGS-GGG-CHHHSS------------------S-SSEEEEEE
T ss_pred             CceEecCChHHHHHHHHHHHhcCCCCC-cccceeecccCccChHH-hhhhcc------------------CCCceEEEEE
Confidence            389999999999999 99999999984 3488999999  99999 885322                  4567999999


Q ss_pred             ccccccCCCCCccccccceeeeecCcccceEeCCCCcEEEEEEeeeeeCCCCCCCCCcCeEEEEEEeC
Q 030306           79 PKHLLYGLTWLPERRAKNGYWKPYGYIDGRIFGACGKLVAIKQSFTFHEPGENIGRKTDWNMTEYRLL  146 (179)
Q Consensus        79 ~~~~k~~~g~R~~R~~~~G~Wk~~G~~~~~I~~~~g~~vG~kk~l~Fy~g~~~~~~kT~W~M~EY~l~  146 (179)
                      ++++++.++.|.+|++++|+||++| +.++|.+.+|.+||+|++|+||.++.+++.+|+|+||||+|.
T Consensus        63 ~~~~~~~~~~r~~R~~~~G~Wk~~g-~~~~i~~~~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   63 PRKKKYPNGGRPNRVTGGGYWKSTG-KEKPIKDPGGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             E----------S-EEETTEEEEEEC-EEEEEEE-TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             ecccccCCcccccccccceEEeecc-cccccccccceeeeeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            9999999999999999999999999 999999778999999999999998888899999999999984


No 2  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=26.66  E-value=49  Score=25.53  Aligned_cols=16  Identities=25%  Similarity=0.627  Sum_probs=12.1

Q ss_pred             CCChHHHHHH----HHHhhc
Q 030306            7 NPFDQSLIKQ----LNNKII   22 (179)
Q Consensus         7 ~PTDeELI~~----L~~Ki~   22 (179)
                      .||||||+..    |+++..
T Consensus        30 tPTeEeL~~r~sPELrkr~~   49 (128)
T PF07960_consen   30 TPTEEELFKRYSPELRKRYL   49 (128)
T ss_pred             CCCHHHHHHhcCHHHHHHHH
Confidence            6999999987    555444


No 3  
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=25.13  E-value=52  Score=16.38  Aligned_cols=8  Identities=13%  Similarity=0.330  Sum_probs=6.5

Q ss_pred             CceEEEee
Q 030306           71 EKGCYVLT   78 (179)
Q Consensus        71 ~~~wyFFs   78 (179)
                      ++.||||.
T Consensus         7 ~~~wYy~~   14 (19)
T PF01473_consen    7 NGNWYYFD   14 (19)
T ss_dssp             TTEEEEET
T ss_pred             CCEEEEeC
Confidence            57899995


No 4  
>PF13822 ACC_epsilon:  Acyl-CoA carboxylase epsilon subunit
Probab=24.98  E-value=37  Score=22.61  Aligned_cols=19  Identities=26%  Similarity=0.303  Sum_probs=12.9

Q ss_pred             cCCChHHHHHH---HHHhhcCC
Q 030306            6 YNPFDQSLIKQ---LNNKIIDE   24 (179)
Q Consensus         6 F~PTDeELI~~---L~~Ki~g~   24 (179)
                      =+||||||-..   |.-.....
T Consensus         9 GnPt~eElAAL~aVlaa~~a~~   30 (62)
T PF13822_consen    9 GNPTDEELAALTAVLAARAAAA   30 (62)
T ss_pred             CCCCHHHHHHHHHHHHHHhccc
Confidence            37999999776   55444443


No 5  
>cd00490 Met_repressor_MetJ Met Repressor, MetJ.  MetJ is a bacterial regulatory protein that uses S-adenosylmethionine (SAM) as a corepressor to regulate the production of Methionine.  MetJ binds arrays of two to five adjacent copies of an eight base-pair 'metbox' sequence.  MetJ forms sufficiently strong interactions with the sugar-phosphate backbone to accomodate sequence variation in natural operators. However, it is very sensitive to particular base changes in the operator. MetJ exists as a homodimer.
Probab=18.37  E-value=1.2e+02  Score=22.07  Aligned_cols=37  Identities=14%  Similarity=0.369  Sum_probs=29.2

Q ss_pred             CCChHHHHHH-HHHhhcCCCCCCCCCceeeccC--CCCCCcCccchh
Q 030306            7 NPFDQSLIKQ-LNNKIIDEPVEFPDLITTEIND--HHPADFFPGSLL   50 (179)
Q Consensus         7 ~PTDeELI~~-L~~Ki~g~pl~~~~~~I~~~Dv--~~Pw~~Lp~~~~   50 (179)
                      |-|..||++- ...-..|+||  |.    +.|+  ..|.+ +|....
T Consensus        50 HATNSELLCEAFLHAfTGQPL--P~----D~Dl~K~~~d~-iP~~ak   89 (103)
T cd00490          50 HATNSELLCEAFLHAFTGQPL--PD----DADLRKERSDE-IPEAAK   89 (103)
T ss_pred             hcccHHHHHHHHHHHhcCCCC--CC----hhhhhhcCccc-ccHHHH
Confidence            4578899999 8888899999  53    5677  77777 887765


No 6  
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=18.06  E-value=84  Score=17.59  Aligned_cols=12  Identities=17%  Similarity=0.279  Sum_probs=10.2

Q ss_pred             ccCCChHHHHHH
Q 030306            5 PYNPFDQSLIKQ   16 (179)
Q Consensus         5 RF~PTDeELI~~   16 (179)
                      ..+||-+|||..
T Consensus         8 ~~RP~~eeLv~r   19 (26)
T smart00707        8 SQRPTREELEER   19 (26)
T ss_pred             HcCCCHHHHHHc
Confidence            478999999976


No 7  
>PF07131 DUF1382:  Protein of unknown function (DUF1382);  InterPro: IPR009814 This entry is represented by Bacteriophage lambda, Xis. This entry overlaps with IPR009750, both representing lambda Xis. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several hypothetical Escherichia coli and Bacteriophage lambda-like proteins of around 60 residues in length. The function of this family is unknown.
Probab=17.55  E-value=1.1e+02  Score=20.61  Aligned_cols=21  Identities=19%  Similarity=0.218  Sum_probs=14.6

Q ss_pred             CCCccCC----ChHHHHHH---HHHhhc
Q 030306            2 ETDPYNP----FDQSLIKQ---LNNKII   22 (179)
Q Consensus         2 ~g~RF~P----TDeELI~~---L~~Ki~   22 (179)
                      .|.||.|    ||+|+...   |..|+.
T Consensus        22 ~GIRFVpiPv~~dee~~~L~s~~~~kLe   49 (61)
T PF07131_consen   22 IGIRFVPIPVVTDEEFHTLSSQLSQKLE   49 (61)
T ss_pred             cCceeeccccccHHHHHHHHHHHHHHHH
Confidence            4789988    67777655   666653


No 8  
>PRK05264 transcriptional repressor protein MetJ; Provisional
Probab=16.26  E-value=1.4e+02  Score=21.94  Aligned_cols=37  Identities=14%  Similarity=0.352  Sum_probs=29.0

Q ss_pred             CCChHHHHHH-HHHhhcCCCCCCCCCceeeccC--CCCCCcCccchh
Q 030306            7 NPFDQSLIKQ-LNNKIIDEPVEFPDLITTEIND--HHPADFFPGSLL   50 (179)
Q Consensus         7 ~PTDeELI~~-L~~Ki~g~pl~~~~~~I~~~Dv--~~Pw~~Lp~~~~   50 (179)
                      |-|..||++- ...-..|+||  |.    +.|+  ..|.+ +|....
T Consensus        51 HATNSELLCEAFLHA~TGQPL--P~----D~Dl~Kd~~d~-ip~~ak   90 (105)
T PRK05264         51 HATNSELLCEAFLHAFTGQPL--PD----DEDLRKERSDE-IPEAAK   90 (105)
T ss_pred             hcccHHHHHHHHHHHHcCCCC--CC----hhhhhhcCccc-chHHHH
Confidence            4578899999 8888899999  53    5677  77777 887664


No 9  
>cd01785 PDZ_GEF_RA Ubiquitin-like domain of PDZ_GEF_RA. PDZ_GEF_RA   PDZ-GEF  is a guanine nucleotide exchange factor (GEF) characterised by the presence of a PSD-95/DlgA/ZO-1 (PDZ) domain, a Ras-association (RA) domain and a region related to a cyclic nucleotide binding domain (RCBD).  RA-GEF exchanges nucleotides of both Rap1 and Rap2, but is also thought to mediate cAMP-induced Ras activation. The RA domain interacts with Rap1 and also contributes to the membrane localization of RA-GEF. This domain may function in a positive feedback loop.
Probab=16.07  E-value=64  Score=23.05  Aligned_cols=31  Identities=13%  Similarity=0.348  Sum_probs=22.8

Q ss_pred             cCeEEEEEEeCCCCCCCCCCEEEEEEEEcC-CccCC
Q 030306          136 TDWNMTEYRLLKHSCTSLDSWVLCKIYWES-EIIEN  170 (179)
Q Consensus       136 T~W~M~EY~l~~~~~~~~~~~VLCrI~~k~-~~~~~  170 (179)
                      ..-.|+||.+...    ...|.||.|--.. +.|++
T Consensus        29 v~lal~eFgi~~~----s~~~sLceVtV~~~g~IKQ   60 (85)
T cd01785          29 VMLALQEFGITAP----SSNFSLCEVSVTPGGVIKQ   60 (85)
T ss_pred             HHHHHHHhCCCCC----ccceEEEEEEecCCceeee
Confidence            4567889999886    4789999998654 44443


No 10 
>PF04700 Baculo_gp41:  Structural glycoprotein p40/gp41 conserved region;  InterPro: IPR006790 This is a family of viral structural glycoproteins [] from the baculoviridae.; GO: 0005198 structural molecule activity, 0019012 virion
Probab=15.59  E-value=1.4e+02  Score=24.47  Aligned_cols=21  Identities=29%  Similarity=0.368  Sum_probs=17.6

Q ss_pred             ccCCChHHHHHH---HHHhhcCCCC
Q 030306            5 PYNPFDQSLIKQ---LNNKIIDEPV   26 (179)
Q Consensus         5 RF~PTDeELI~~---L~~Ki~g~pl   26 (179)
                      ||. +|++||.|   |.+|..|...
T Consensus         3 RF~-sDe~Li~yY~~L~K~~g~~~~   26 (186)
T PF04700_consen    3 RFE-SDEELIEYYANLEKKYGGSDV   26 (186)
T ss_pred             ccc-cHHHHHHHHHHHHHHhCCCCC
Confidence            443 79999999   8899998887


Done!